Recombinant Schizosaccharomyces pombe ERAD-associated E3 ubiquitin-protein ligase hrd1 (hrd1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in ERAD

hrd1 facilitates the ubiquitination of misfolded ER proteins, marking them for retrotranslocation and proteasomal degradation. Key findings include:

Core ERAD Functions

  • Substrate Recognition: Targets lumenal and membrane-bound misfolded proteins (e.g., mutant carboxypeptidase Y, ScCPY*) .

  • E2 Interaction: Partners with Ubc7p homologs for ubiquitin transfer .

  • N-Glycosylation Independence: Efficiently degrades substrates lacking N-linked oligosaccharides .

Comparative Homology

Human HRAD1 (homologous to S. pombe rad1) complements UV sensitivity in S. pombe rad1 mutants, confirming conserved checkpoint roles .

Post-Translational Modifications (PTMs)

Phosphorylation sites in hrd1 modulate its activity:

SitePTM TypeScoreSourcesPMIDs
S353Phosphorylation1PomBase29996109, 25720772
S359Phosphorylation1PomBase29996109, 25720772
S360Phosphorylation1PomBase33823663, 25720772
T362Phosphorylation1PomBase25720772
S367Phosphorylation2PomBase, UniProt18257517, 30726745, etc.

Phosphorylation at S367 is highly conserved and critical for regulatory functions .

Recombinant Protein Uses

  • Functional Studies: Investigates ERAD efficiency and substrate specificity .

  • Mutational Analysis: Residues in cytosolic regions (e.g., disordered loops) regulate retrotranslocation directionality .

  • Homology Studies: Cross-species comparisons (e.g., human HRAD1) validate conserved mechanisms .

Key Research Findings

  1. ERAD Independence from N-Glycosylation: Mutant CPY* (ScCPY*) lacking glycosylation is degraded via hrd1-dependent ERAD in S. pombe .

  2. Role in Metabolism: Human HRD1 degrades ENTPD5, linking ERAD to AMPK activation and liver metabolism .

  3. Immune Regulation: Hrd1 deficiency in B cells disrupts pre-BCR ubiquitination, impairing developmental checkpoints .

  4. Structural Insights: Deep mutational scanning identifies cytosolic regions critical for substrate interaction and autoubiquitination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
hrd1; SPBC17D11.02c; ERAD-associated E3 ubiquitin-protein ligase hrd1; RING-type E3 ubiquitin transferase hrd1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-677
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
hrd1
Target Protein Sequence
MKFILYVLASLVLFGLSVLLSLYSSANVYSATVMISQSPVHITIGLNVCLCLFFAIANAL KTLLFGSLQTFELELLYEQFWITLTEIMLAITVFREAISISFFMLLSTLMFARVFHSICS FRTERLQIQLTDQRFHIFSRLTCAYFVLSILDASLIYLCFTSEHLGDKSTRMLFVCEFSV LLLNLTIEASKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLRLLAYSLLFMYQFPYVS VPIYSIRQMYTCFYSLFRRIREHARFRQATRDMNAMYPTATEEQLTNSDRTCTICREEMF HPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSVIGNQSS PTGIPASPNVRATQIATQVPNPQNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFA AHTQDLSSVIPRRIALRDGWTMLPIPGTRRIPTYSQSTSTTNPSATPTTGDPSNSTYGGP QTFPNSGNNPNFNRGIAGIVPPGWRLVSSNTQSLSTNSAMTSLYQNASSADNNLGSSLPN VVPLSRGLTQSNETSNTFPAASSNISSQLRELHTKIDELRETVSNFRADYNSIRTSLNQL EAASGINERIQTTSADSLLNSNGMSGTEGFENTQTSITTNDNQSSILTSSDQTSPFATDE DRQNSRNVQLETVDENF
Uniprot No.

Target Background

Function

Hrd1 is a Schizosaccharomyces pombe E3 ubiquitin-protein ligase. It specifically accepts ubiquitin from endoplasmic reticulum-associated E2 ligases and transfers it to substrates, targeting them for degradation. Hrd1 mediates the degradation of endoplasmic reticulum (ER) proteins (ERQC), also known as ER-associated degradation (ERAD). It's a component of the hrd1 ubiquitin ligase complex, involved in the ERAD-L and ERAD-M pathways. These pathways degrade misfolded soluble lumenal and membrane proteins with misfolded lumenal domains (ERAD-L), or ER-membrane proteins with misfolded transmembrane domains (ERAD-M). In conjunction with Ubc7, hrd1 is essential for the degradation of the Sre1 transcription factor precursor when its binding partner, Scp1, is absent.

Database Links
Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ERAD-associated E3 ubiquitin-protein ligase hrd1 in S. pombe?

S. pombe hrd1 (UniProt ID: O74757, HRD1_SCHPO) is an E3 ubiquitin-protein ligase that plays a central role in endoplasmic reticulum-associated degradation (ERAD). Structurally, hrd1 contains multiple transmembrane domains that anchor it to the ER membrane and form a channel through which misfolded proteins can be transported. It possesses a cytosolic RING-H2 finger domain that catalyzes the transfer of ubiquitin to substrate proteins, targeting them for degradation by the 26S proteasome.

Cryo-EM studies have revealed that Hrd1 molecules interact through their transmembrane domains to form dimers, while Hrd3 (a key cofactor) molecules form an arch on the luminal side . The RING finger domains are flexibly attached to the membrane domains, allowing them to interact with E2 ubiquitin-conjugating enzymes. This architecture creates a comprehensive quality control system where Hrd3 can identify and deliver substrates to the Hrd1 channel.

The primary function of hrd1 is protein quality control - recognizing and facilitating the degradation of misfolded or unassembled proteins in the ER. This process is essential for maintaining ER homeostasis and preventing cellular stress caused by protein aggregation.

How does S. pombe hrd1 compare with its homologs in other organisms?

S. pombe hrd1 shares significant structural and functional similarities with its homologs in other organisms while exhibiting some notable differences:

OrganismProtein NameKey SimilaritiesNotable Differences
S. pombehrd1RING-H2 finger domain, ER membrane localizationContains specific phosphorylation sites (S353, S359, S360, T362, S367)
S. cerevisiaeHrd1p/Der3pCore ERAD function, similar domain organizationDifferent regulatory mechanisms
HumansHRD1/SYVN1Conserved RING-H2 finger domain, ER localizationAdditional interactions with human-specific cofactors like FAM8A1 and Herp ; expanded functions in apoptosis regulation

Human HRD1 has evolved additional functional roles beyond the canonical ERAD pathway, including regulation of the death receptor CD95/Fas and involvement in B-cell immunity . Studies have shown that human HRD1 protected B cells from activation-induced cell death by degrading the death receptor Fas . Additionally, hypomorphic variants of human SEL1L and HRD1 have been associated with neurodevelopmental disorders, highlighting its importance in human physiology .

The presence of metazoan-specific factors associated with Hrd1 suggests fundamental differences may have evolved between lower and higher eukaryotes, potentially to promote distinct organizational strategies or substrate processing mechanisms .

What are the known post-translational modifications of S. pombe hrd1?

According to the iPTMnet database, S. pombe hrd1 undergoes several phosphorylation events that potentially regulate its activity and interactions:

SitePTM TypePTM EnzymeScoreSourcePMID
S353Phosphorylationscore1PomBase29996109, 25720772
S359Phosphorylationscore1PomBase29996109, 25720772
S360Phosphorylationscore1PomBase33823663, 25720772
T362Phosphorylationscore1PomBase25720772
S367Phosphorylationscore2PomBase, UniProt18257517, 30726745, 29996109, 25720772, 33823663

These phosphorylation sites are located in regions that may affect protein-protein interactions or the activity of the ubiquitin ligase domain . The presence of multiple phosphorylation sites suggests a complex regulatory mechanism for controlling hrd1 function in response to cellular conditions or stress.

Researchers investigating these modifications typically employ phospho-specific antibodies, mass spectrometry, and mutagenesis approaches to understand their role in regulating hrd1 activity. Site-directed mutagenesis of these phosphorylation sites (e.g., changing serine/threonine to alanine to prevent phosphorylation or to aspartate/glutamate to mimic constitutive phosphorylation) can provide insights into their functional significance.

What expression systems are optimal for producing recombinant S. pombe hrd1 protein?

Several expression systems can be used for producing recombinant S. pombe hrd1, each with specific advantages and limitations:

Expression SystemAdvantagesLimitationsKey Considerations
E. coliHigh yield, rapid growth, economicalLacks eukaryotic post-translational modifications, potential inclusion body formationOptimal for isolated domains (e.g., RING domain) rather than full-length protein
S. pombeNative post-translational modifications, proper foldingLower yield compared to E. coli, longer growth timeExcellent for functional studies requiring authentic protein
S. cerevisiaeEukaryotic modifications, established protocolsMay have different glycosylation patternsGood alternative to S. pombe with higher expression potential
Insect cellsHigh-level expression of membrane proteins, eukaryotic modificationsMore complex and expensiveSuitable for structural studies requiring large amounts of properly folded protein

For S. pombe expression, vectors such as pESP-1 and pESP-2 have been developed specifically for protein expression in this organism. These vectors use the nmt1 promoter for constitutive or induced expression of the gene of interest . The GST tag can be used for purification, with options for tag removal via thrombin or enterokinase proteases. Proteins expressed from the pESP-2 vector will yield native amino acid sequence when the GST tag is removed by enterokinase treatment . Yields from this system typically range from 1.0 mg/L to 12.5 mg/L of induced culture.

When expressing membrane proteins like hrd1, careful optimization of induction conditions, temperature, and detergent selection for extraction is crucial for maintaining protein structure and function.

How can proteolytic degradation of recombinant S. pombe hrd1 be minimized during expression and purification?

Proteolytic degradation is a significant challenge when working with recombinant proteins in S. pombe. For a complex membrane protein like hrd1, this issue requires particular attention:

1. Use of protease-deficient strains:
A comprehensive set of 52 protease-deficient S. pombe strains has been constructed specifically to address proteolytic degradation of recombinant proteins . Functional screening of these strains using human growth hormone (hGH) as a model protein identified several disruptants that were effective in reducing protein degradation. These strains are particularly valuable for proteins that are sensitive to proteolysis.

2. Optimization of growth and induction conditions:

  • Lower temperature (25°C) during induction phase

  • Shorter induction times may yield less degraded protein

  • Harvest cells at optimal growth phase (typically early to mid-log phase)

3. Buffer and additive optimization during purification:

  • Include comprehensive protease inhibitor cocktails specific for serine, cysteine, aspartic, and metalloproteases

  • Maintain samples at 4°C throughout purification

  • Add stabilizing agents such as glycerol (10-15%) and reducing agents

4. Protease inhibitor strategy:

Protease TypeInhibitorsWorking Concentration
Serine proteasesPMSF, Aprotinin, LeupeptinPMSF (1 mM), Aprotinin (2 μg/ml), Leupeptin (10 μg/ml)
Cysteine proteasesE-64, LeupeptinE-64 (10 μM), Leupeptin (10 μg/ml)
Aspartic proteasesPepstatin APepstatin A (1 μg/ml)
MetalloproteasesEDTA, EGTAEDTA (5 mM), EGTA (2 mM)

5. Purification strategy modifications:

  • Implement rapid purification protocols to minimize time in solution

  • Use buffer systems optimized to reduce protease activity (typically pH 7.5-8.0)

  • Consider on-column digestion for tag removal to minimize exposure to proteases

The construction of protease-deficient strain sets is not only useful for practical application in protein production but also for functional screening, specification, and modification of proteases in S. pombe .

How can I verify the enzymatic activity of purified recombinant S. pombe hrd1?

Verifying the enzymatic activity of purified recombinant S. pombe hrd1 is crucial to ensure the protein is properly folded and functional. Several complementary approaches can be used:

1. In vitro ubiquitination assay:

  • Components needed:

    • Purified recombinant hrd1

    • Recombinant E1 (ubiquitin-activating enzyme)

    • Recombinant E2 (ubiquitin-conjugating enzyme, preferably UBC7)

    • Ubiquitin (wild-type or tagged)

    • ATP and Mg²⁺

    • Known substrate or model substrate

  • Procedure:

    • Incubate all components at 30°C for 1-2 hours

    • Analyze by SDS-PAGE followed by western blotting with anti-ubiquitin antibodies

    • Observe the formation of ubiquitin chains or ubiquitinated substrate

From studies with human HRD1, we know that in the presence of the ubiquitin-conjugating enzyme UBC7, the RING-H2 finger has in vitro ubiquitination activity for Lys(48)-specific polyubiquitin linkage, suggesting similar activity for S. pombe hrd1 .

2. Functional complementation:
Test whether the recombinant protein can rescue phenotypes in hrd1-deficient cells. For instance, human HRD1 appears to be involved in the basal degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase and in the elimination of model ERAD substrates like TCR-alpha and CD3-delta . A similar approach could be used with S. pombe hrd1.

3. Binding assays with known interactors:

  • Co-immunoprecipitation with known binding partners (e.g., Hrd3)

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • GST pull-down assays to verify protein-protein interactions

4. Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Limited proteolysis to verify proper folding

  • Thermal shift assays to evaluate protein stability

The presence of the expected post-translational modifications can also be verified using mass spectrometry, particularly the phosphorylation sites mentioned earlier (S353, S359, S360, T362, S367) .

How does S. pombe hrd1 select its substrates for ubiquitination?

The substrate selection mechanism of S. pombe hrd1 involves a complex interplay of direct recognition and cofactor-mediated interactions:

Direct recognition mechanisms:

  • Recognition of exposed hydrophobic patches in misfolded proteins

  • Binding to specific amino acid sequences or structural motifs

  • Interaction with glycan structures on glycoproteins

Cofactor-mediated substrate recognition:
S. pombe hrd1 works with several cofactors that help in substrate recognition:

CofactorFunction in Substrate SelectionInteraction with hrd1
Hrd3Acts as a substrate receptor; contributes to forming an arch on the luminal sideInteracts with transmembrane domains of hrd1
Yos9 (inferred from homology)Recognizes specific glycan structures on misfolded glycoproteinsIndirect interaction via Hrd3
Der1 (inferred from homology)Facilitates transfer of substrates to the retrotranslocation channelLikely interacts with transmembrane regions

Structural basis of substrate selection:
Cryo-EM structures of the Hrd1 complex suggest that:

  • Hrd1 forms a dimer with its transmembrane domains creating a channel or pore

  • Hrd3 molecules form an arch on the luminal side of the ER membrane

  • This architecture creates a comprehensive quality control system where Hrd3 can identify and deliver substrates to the Hrd1 channel

From studies of human HRD1, we know that it is involved in the degradation of specific substrates like 3-hydroxy-3-methylglutaryl-coenzyme A reductase and model ERAD substrates such as TCR-alpha and CD3-delta . The mammalian Hrd1 has also been shown to regulate the death receptor Fas, suggesting substrate specificity beyond classical ERAD targets .

Advanced research questions currently being investigated include:

  • How conformational changes in hrd1 may regulate its channel function

  • Whether post-translational modifications (particularly phosphorylation) alter substrate selectivity

  • The role of membrane lipid composition in modulating hrd1 activity

What cofactors interact with S. pombe hrd1 to form functional ERAD complexes?

S. pombe hrd1 forms a multi-protein complex with several cofactors to execute ERAD. Based on the available data and inferred from homology with other organisms, the following cofactors are likely to interact with S. pombe hrd1:

Key cofactors and their interactions:

CofactorFunctionInteraction DomainEvidence
Hrd3Substrate recognition and deliveryInteracts with transmembrane domains of hrd1Cryo-EM structures show Hrd3 forming an arch on the luminal side of the hrd1 dimer
Der1 (inferred)Retrotranslocation of ERAD substratesLikely interacts with transmembrane regionsBased on homology with other systems
Usa1 (inferred)Scaffold protein, stabilizes Hrd1-Der1 interactionUnknown in S. pombeBased on homology with other systems
Ubx2 (inferred)Recruits Cdc48/p97 for substrate extraction from ERLikely cytosolic domainBased on homology with other systems
Yos9 (inferred)Recognition of glycosylated ERAD substratesIndirect via Hrd3Based on homology with other systems

Assembly architecture:
Cryo-EM studies have provided insights into how these components might assemble:

  • Hrd1 molecules interact through their transmembrane domains to form dimers

  • Hrd3 molecules form an arch on the luminal side

  • The RING finger domains of Hrd1 are flexibly attached to the membrane domains

In mammalian systems, an evolutionarily conserved segment within the intrinsically disordered cytoplasmic domain of Hrd1 (termed the HAF-H domain) engages complementary segments in the cofactors FAM8A1 and Herp . This domain is required for Hrd1 to interact with both FAM8A1 and Herp, as well as to assemble higher-order Hrd1 complexes. While the exact conservation of these interactions in S. pombe remains to be determined, they provide insights into potential interaction mechanisms.

Research techniques to study these interactions include:

  • Co-immunoprecipitation and pull-down assays

  • Crosslinking mass spectrometry

  • FRET-based interaction assays

  • Genetic studies using deletion or mutation of potential cofactors

What advantages does S. pombe offer as a host for studying ERAD pathway components?

S. pombe offers several distinct advantages as a model system for studying ERAD components like hrd1:

Biological and genetic advantages:

  • Evolutionary conservation:

    • S. pombe shares more similarities with metazoans in many cellular processes compared to S. cerevisiae

    • Core ERAD machinery is conserved but simpler than in mammals, making it easier to study

  • Genetic tractability:

    • Well-established methods for gene deletion, modification, and replacement

    • Haploid genome simplifies genetic analysis

    • Efficient homologous recombination facilitates precise genetic engineering

  • Cell biology:

    • Compartmentalized ER similar to higher eukaryotes

    • Post-translational modifications more similar to mammals than S. cerevisiae

    • Protein quality control systems representative of those in higher eukaryotes

Experimental advantages for ERAD studies:

FeatureAdvantage for ERAD ResearchComparison to Other Systems
Growth characteristicsRapid growth (3-4 hour doubling time), easy cultivationFaster than mammalian cells, similar to S. cerevisiae
ERAD pathway complexityCore components present but fewer redundant genesSimpler than mammals, comparable to S. cerevisiae
Stress response systemsWell-characterized UPR and ERAD pathwaysMore similar to mammals than S. cerevisiae in some aspects
Tools for protein studiesEstablished protocols for protein expression and purification Superior to mammalian cells for yield, inferior to E. coli
Membrane protein expressionGood track record for expressing membrane proteinsBetter than E. coli, comparable to S. cerevisiae

Specific advantages for hrd1 studies:

  • Natural phosphorylation patterns can be studied (sites identified: S353, S359, S360, T362, S367)

  • Ability to study hrd1 in its native cellular context

  • Potential to identify novel interaction partners using genetic screens

  • Capacity to study the function of hrd1 in response to various stress conditions

Unlike E. coli, S. pombe provides for post-translational modifications of proteins, which are often critical for the structure and function of eukaryotic proteins . This makes it particularly valuable for studying complex proteins like hrd1 that require these modifications for proper function.

How do structural changes in hrd1 affect its ubiquitin ligase activity?

The relationship between structural changes in hrd1 and its ubiquitin ligase activity is a complex area of research that requires understanding of structure-function relationships:

Critical structural elements affecting activity:

  • RING-H2 finger domain:

    • Contains the catalytic core for E3 ligase activity

    • Coordinates zinc ions through cysteine and histidine residues

    • Mutations in the zinc-coordinating residues typically abolish ligase activity

    • Proper folding of this domain is essential for recruiting and positioning the E2 enzyme

Human HRD1 studies have shown that the RING-H2 finger domain has in vitro ubiquitination activity for Lys(48)-specific polyubiquitin linkage in the presence of the ubiquitin-conjugating enzyme UBC7 . The S. pombe hrd1 is expected to have similar requirements for its activity.

  • Transmembrane domains:

    • Form a channel or pore for substrate retrotranslocation

    • Alterations in the transmembrane topology can affect substrate access

    • Mutations that disrupt the channel structure impair ERAD function

    • Dimerization of hrd1 through transmembrane domains is critical for activity

Cryo-EM studies have shown that the transmembrane domains of Hrd1 interact to form dimers, providing a structural basis for channel formation and substrate translocation .

  • Cytoplasmic linker regions:

    • Connect the transmembrane domains to the RING-H2 finger

    • Provide flexibility needed for ubiquitination of diverse substrates

    • May contain regulatory phosphorylation sites

Effects of pathogenic variants:
From studies of human HRD1 variants, we can infer potential effects in S. pombe:

  • The HRD1 p.Pro398Leu variant impairs HRD1 activity

  • SEL1L variants p.Gly585Asp and p.Met528Arg affect substrate recruitment and SEL1L-HRD1 complex formation, respectively

These hypomorphic variants of SEL1L-HRD1 ER-associated degradation are associated with neurodevelopmental disorders, highlighting the importance of proper structural conformations for function .

In mammalian systems, an evolutionarily conserved segment within the intrinsically disordered cytoplasmic domain of Hrd1 (the HAF-H domain) is required for Hrd1 to interact with cofactors and assemble higher-order Hrd1 complexes . Structural changes in this domain would therefore affect complex formation and activity.

Methodological approaches to study structure-function relationships:

  • Site-directed mutagenesis of key residues followed by functional assays

  • Deletion mapping to identify minimal functional domains

  • Introduction of conformational sensors to monitor structural changes

  • Cryo-EM analysis of wild-type and mutant proteins to identify structural differences

What strategies can improve the solubility of recombinant S. pombe hrd1?

As a multi-spanning membrane protein, hrd1 presents significant solubility challenges. Several strategies can improve the solubility of recombinant S. pombe hrd1:

Detergent-based solubilization approaches:

DetergentPropertiesTypical ConcentrationSuitability for hrd1
DDM (n-Dodecyl β-D-maltoside)Mild, non-ionic1% for extraction, 0.05% for purificationHigh - preserves protein-protein interactions
LMNG (Lauryl Maltose Neopentyl Glycol)Mild, low CMC1% for extraction, 0.01% for purificationHigh - excellent for structural studies
DigitoninVery mild, steroid-based1-2% for extraction, 0.1% for purificationHigh - good for preserving complexes
GDN (Glyco-Diosgenin)Mild, digitonin analog1% for extraction, 0.02% for purificationHigh - improved stability over digitonin

Cryo-EM studies on Hrd1 complexes have utilized such detergents for solubilization and structural analysis, providing evidence for their effectiveness .

Membrane mimetic systems:

  • Nanodiscs:

    • Phospholipid bilayers encircled by membrane scaffold proteins

    • Allow reconstitution of hrd1 in a native-like membrane environment

    • Improve stability and facilitate functional studies

  • Amphipols:

    • Amphipathic polymers that wrap around the hydrophobic regions

    • Can replace detergents after initial solubilization

    • Provide exceptional stability for structural studies

  • Styrene-Maleic Acid Lipid Particles (SMALPs):

    • Allow direct extraction of membrane proteins with surrounding lipids

    • Preserve the native lipid environment

    • Eliminate the need for detergent solubilization

Fusion protein approaches:

  • N-terminal fusions with soluble proteins like GST, MBP, or SUMO

  • C-terminal GFP fusion to monitor folding and solubility

  • Inclusion of purification tags that enhance solubility

The GST fusion system has been successfully used with S. pombe proteins, with the GST tag providing both solubility enhancement and purification capability. Proteins expressed from the pESP-2 vector yield native amino acid sequence when the GST tag is removed by enterokinase treatment .

Buffer optimization:

  • Include glycerol (10-20%) to stabilize hydrophobic regions

  • Add stabilizing agents like cholesterol hemisuccinate (CHS) at 0.1%

  • Optimize pH and ionic strength based on protein stability profile

  • Include specific lipids that may be required for stability

For challenging membrane proteins like hrd1, a systematic screening of multiple solubilization conditions is often necessary to identify optimal conditions. High-throughput approaches using different detergent/lipid combinations can accelerate this process.

How can S. pombe be genetically modified to enhance recombinant protein production?

Several genetic modifications can significantly improve S. pombe as a host for recombinant protein production, especially for challenging proteins like hrd1:

Key genetic modifications for enhanced protein expression:

  • Protease deletion strains:

    • A comprehensive set of 52 protease-deficient S. pombe strains has been constructed

    • These strains showed reduced degradation of heterologous proteins

    • Functional screening demonstrated that some of the resultant disruptants were effective in reducing protein degradation, particularly for proteolytically sensitive proteins like human growth hormone (hGH)

  • Expression system optimization:

    • Vectors like pESP-1 and pESP-2 use the nmt1 promoter for constitutive or induced expression

    • GST-tagged proteins can be easily purified using glutathione agarose beads

    • The GST tag can be removed by treatment with either thrombin or enterokinase protease

  • Secretory pathway engineering:

    • Modification of ERAD components to prevent premature degradation of recombinant proteins

    • Engineering of Golgi-to-ER retrieval systems to enhance ER retention when desired

  • Transcriptional and translational enhancements:

    • Integration of multiple gene copies at defined genomic loci

    • Codon optimization based on S. pombe preferred codons

    • Strengthening of ribosome binding sites

Specific modifications for membrane protein expression:

ModificationPurposeExpected Improvement
Deletion of specific ERAD componentsPrevent premature degradation of membrane proteinsIncreased yield of difficult-to-express proteins
Overexpression of membrane insertion factorsFacilitate proper insertion into ER membraneImproved folding and reduced aggregation
Lipid biosynthesis engineeringOptimize membrane compositionEnhanced stability of membrane proteins

Implementation strategy:

  • Generate base strains with essential modifications (protease deficiencies)

  • Introduce additional modifications based on protein-specific challenges

  • Validate strains with model proteins before attempting expression of challenging targets like hrd1

  • Fine-tune expression conditions for each engineered strain

The construction of a protease-deficient strain set is not only useful for practical application in protein production but also for functional screening, specification, and modification of proteases in S. pombe, where further investigations of proteolytic processes and improvement through multiple gene manipulations are required .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.