Recombinant Schizosaccharomyces pombe Fe (2+)/Mn (2+) transporter pcl1 (pcl1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Pcl1 is a 242-amino acid transmembrane protein (UniProt ID: Q9P6J2) belonging to the cation diffusion facilitator (CDF) family. Key features include:

Biological Function

Pcl1 facilitates the transport of Fe²⁺ and Mn²⁺ across cellular membranes, critical for metalloenzyme activity and oxidative stress resistance. Key regulatory mechanisms include:

  • Iron-dependent repression: Under iron-limiting conditions, the transcription factor Php4 downregulates pcl1 mRNA via a CCAAT-box motif in its promoter .

  • Interaction with CCAAT-binding complex: The heteromeric Php2/Php3/Php5 complex modulates pcl1 transcription, linking iron homeostasis to mitochondrial respiration .

  • Role in oxidative phosphorylation: Pcl1 depletion disrupts iron-sulfur cluster assembly and electron transport chain components (e.g., sdh4) .

Expression and Purification

Recombinant Pcl1 is produced in E. coli with high yield (~1 mg/mL). Protocols involve:

  • Lyophilization: Stabilized in Tris/PBS buffer with trehalose .

  • Tagging: His-tagged for affinity chromatography .

  • Quality control: Validated by SDS-PAGE and ELISA .

Research Applications

ApplicationUse CaseSource
Metal transport studiesMechanistic analysis of Fe²⁺/Mn²⁺ uptake
Gene regulation assaysPromoter analysis (e.g., CCAAT mutagenesis)
Antibody productionRabbit polyclonal antibodies for WB/ELISA

Table 2: Regulatory Insights from Functional Studies

Study FocusKey ResultImplication
Promoter analysisCCAAT box (-205 to -201) essential for repression under low ironIdentifies cis-regulatory element
Php4 interactionphp4Δ mutants show constitutive pcl1 expressionPhp4 acts as an iron-sensitive repressor
Cross-species homologyFunctional overlap with S. cerevisiae CCC1Conserved role in metal transport

Future Directions

Current research gaps include structural resolution of Pcl1’s metal-binding domains and its interplay with other transporters (e.g., Fio1/Fip1). Recombinant Pcl1’s stability and high purity make it suitable for crystallography and drug screening targeting metal-related disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
pcl1; SPBC1683.10c; Fe(2+/Mn(2+ transporter pcl1; Pombe ccc1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pcl1
Target Protein Sequence
MWSIFEARPKEAHSVNKIGWLRASVLGANDGILSLSGLLVGVVAANADIKVILITGVAGL MSGALSMAVGEYVSVSSQADLEDADLQLERREMDADWDAEVDELAAIYRGRGLDEELSRT VAVQLMEYNALEAHARDELGINIHTTAKPTLAALSSAASFSVGGIFPLLTSLITPLEYLS LVLPIATMFFLGMLGFVGAHIGGAKRVRAILRAVVLGLLAMAATALVGRLLEIHALSLQY AI
Uniprot No.

Target Background

Function
Plays a role in both calcium and manganese homeostasis. Involved in the transfer of iron and Mn(2+) from the cytosol to the vacuole for storage of these metals.
Database Links
Protein Families
CCC1 family
Subcellular Location
Endoplasmic reticulum. Golgi apparatus membrane. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Schizosaccharomyces pombe Fe(2+)/Mn(2+) transporter pcl1 and what cellular roles does it fulfill?

Recombinant Schizosaccharomyces pombe Fe(2+)/Mn(2+) transporter pcl1 is a full-length protein (242 amino acids) that belongs to the CCC1 (Ca²⁺-sensitive cross complementer1) transporters in the VIT (vacuolar iron transporter) subfamily . The protein functions primarily as a divalent metal transporter, facilitating the export of Mn²⁺ and Fe²⁺ ions from the cytosol into intracellular compartments. In S. pombe, pcl1 is integral to the cellular metal homeostasis machinery, protecting against toxic accumulation of these transition metals while ensuring their availability for essential metabolic processes.

The recombinant version typically refers to the protein expressed in heterologous systems (commonly E. coli) with an affinity tag (such as His-tag) to facilitate purification for functional or structural studies . Its UniProt ID is Q9P6J2, with synonyms including SPBC1683.10c and Pombe ccc1-like protein 1 .

How does pcl1 contribute to metal homeostasis in S. pombe compared to other yeast systems?

In S. pombe, pcl1 functions within a network of transporters that maintain manganese and iron homeostasis. Unlike Saccharomyces cerevisiae, which primarily uses Ccc1 for vacuolar iron sequestration, S. pombe employs pcl1 as part of a more diversified metal homeostasis system . The protein is believed to export Mn²⁺ from the cytosol into intracellular compartments (likely vacuoles), protecting against manganese toxicity.

Comparative analysis with other fungal systems reveals that:

OrganismTransporterSubcellular LocationPrimary Function
S. pombepcl1Vacuole/GolgiMn²⁺/Fe²⁺ export from cytosol
S. cerevisiaePmr1pGolgiMn²⁺ export from cytosol
S. cerevisiaeYpk9pVacuoleMn²⁺ export from cytosol
S. cerevisiaeCod1pERMn²⁺ export from cytosol

These transporters work in concert with importers like Smf1/Smf2 (Nramp family), Pho84 (phosphate transporter), and Atx2 (ZIP family) to maintain optimal metal concentrations in different cellular compartments .

How does the coordination chemistry of pcl1 determine its selectivity between Fe(2+) and Mn(2+)?

The coordination chemistry of pcl1's metal-binding sites plays a crucial role in determining its selectivity between Fe(2+) and Mn(2+). While detailed crystallographic data specific to pcl1 is limited, structural comparisons with related transporters suggest that pcl1 likely contains coordination spheres with oxygen and nitrogen donor ligands, which are prevalent in proteins that bind transition metals .

Metal selectivity in pcl1 may arise from:

  • Coordination geometry: Mn²⁺ typically prefers octahedral coordination with six ligands, while Fe²⁺ can adopt various coordination numbers (4-6).

  • Ligand identity: The presence of specific amino acid residues (histidine, aspartate, glutamate, cysteine) in the binding pocket.

  • Bond lengths and angles: Variations in metal-ligand bond distances can favor one metal over another.

To experimentally determine the coordination chemistry and selectivity of pcl1, researchers should employ spectroscopic techniques such as X-ray absorption spectroscopy (XAS), electron paramagnetic resonance (EPR), and isothermal titration calorimetry (ITC) to measure binding affinities for different metals under varying pH and redox conditions .

What methodologies can effectively assess the kinetic parameters of metal transport by pcl1?

Determining the kinetic parameters of pcl1-mediated metal transport requires specialized methodologies that can accurately measure metal movement across membranes. The following approaches are recommended:

  • Reconstituted Proteoliposome Assays: Purified recombinant pcl1 can be incorporated into artificial liposomes loaded with fluorescent metal sensors. Transport activity is measured by monitoring fluorescence changes upon metal addition.

  • Radioisotope Flux Measurements: Using ⁵⁵Fe or ⁵⁴Mn isotopes to trace metal movement into vesicles containing pcl1.

  • Whole-Cell Metal Accumulation: Compare metal uptake in wild-type vs. pcl1-knockout S. pombe cells using inductively coupled plasma mass spectrometry (ICP-MS).

Kinetic parameters should be determined under varying conditions:

ParameterRecommended RangeAnalysis Method
K<sub>m</sub>1-100 μM metal ionLineweaver-Burk plot
V<sub>max</sub>Dependent on expression levelDirect fitting to Michaelis-Menten equation
pH dependencepH 5.0-8.0Transport activity vs. pH curve
Temperature dependence20-37°CArrhenius plot

For competitive inhibition studies, analyze transport in the presence of other divalent metals (Zn²⁺, Ca²⁺, Co²⁺) to establish specificity profiles .

What are the optimal conditions for expressing and purifying recombinant pcl1?

For optimal expression and purification of recombinant pcl1, researchers should consider the following methodological approach:

Expression System:

  • Host: E. coli BL21(DE3) or Rosetta(DE3) for membrane proteins

  • Vector: pET series with N-terminal His-tag

  • Induction: 0.1-0.5 mM IPTG at lower temperatures (16-18°C) for membrane proteins

  • Growth media: Terrific Broth supplemented with 1% glucose to improve membrane protein expression

Purification Protocol:

  • Membrane isolation using differential centrifugation

  • Solubilization with mild detergents (DDM, LDAO, or Fos-choline-12)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final purification

For reconstitution and storage, follow these guidelines:

  • Reconstitute in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • For long-term storage, add glycerol to 50% final concentration and store at -80°C

  • Avoid repeated freeze-thaw cycles as they compromise protein stability

How can researchers effectively study the in vivo localization and trafficking of pcl1?

To investigate pcl1 localization and trafficking in vivo, researchers should employ complementary methodologies:

  • Fluorescent Protein Tagging:

    • Generate C-terminal GFP or mCherry fusions of pcl1

    • Verify functionality of tagged constructs through complementation assays

    • Image using confocal microscopy with appropriate organelle markers

  • Immunolocalization:

    • Develop specific antibodies against pcl1 or use anti-His antibodies for the recombinant version

    • Perform immunofluorescence with co-localization markers for vacuoles, Golgi, and ER

    • Use gold-labeled secondary antibodies for immuno-electron microscopy to achieve nanometer resolution

  • Subcellular Fractionation:

    • Isolate specific organelles through differential centrifugation

    • Analyze pcl1 distribution by Western blotting

    • Correlate protein presence with organelle-specific markers

  • Live-Cell Imaging:

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Use pulse-chase experiments with inducible promoters to track protein movement

Data analysis should quantify co-localization coefficients and conduct statistical comparisons between wild-type and mutant forms of the protein under various metal stress conditions.

How should researchers interpret apparently contradictory data regarding pcl1 metal specificity?

When encountering contradictory data regarding pcl1 metal specificity, researchers should systematically analyze potential sources of discrepancy:

  • Experimental Conditions Assessment:

    • Compare buffer compositions, pH values, and redox states across studies

    • Evaluate metal contamination in reagents using ICP-MS

    • Consider differences in protein preparation methods

  • Methodological Cross-Validation:

    • Employ multiple independent techniques to measure metal binding/transport

    • Compare in vitro binding studies with in vivo functional assays

    • Conduct isothermal titration calorimetry under standardized conditions

  • Statistical Analysis Framework:

    • Perform meta-analysis when sufficient data exists

    • Apply Bayesian statistical approaches to integrate conflicting datasets

    • Calculate confidence intervals to determine overlap between seemingly contradictory results

  • Biological Context Consideration:

    • Evaluate whether discrepancies reflect genuine biological variability

    • Consider strain-specific differences in S. pombe

    • Assess whether pcl1 displays condition-dependent specificity shifts

A decision matrix approach can help resolve contradictions:

Observation TypeWeight FactorValidation Method
Direct binding measurementsHighReplicate with multiple techniques
Transport assaysHighVerify with both radioactive and fluorescent methods
Mutant phenotypesMediumCross-validate with heterologous expression
Computational predictionsLowConfirm experimentally

What computational approaches can advance understanding of pcl1 structure-function relationships?

Computational approaches offer powerful tools for investigating pcl1 structure-function relationships when experimental data is limited:

  • Homology Modeling:

    • Build pcl1 structural models based on related transporters with known structures

    • Validate models using energy minimization and Ramachandran plot analysis

    • Generate multiple models using different templates and evaluate consistency

  • Molecular Dynamics Simulations:

    • Simulate pcl1 behavior in lipid bilayer environments

    • Analyze conformational changes during transport cycles

    • Model metal ion interactions with binding sites

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Apply to metal coordination sites for accurate electronic structure calculations

    • Predict binding energies and selectivity between Fe²⁺ and Mn²⁺

    • Evaluate transition states during transport process

  • Evolutionary Coupling Analysis:

    • Identify co-evolving residues suggesting functional importance

    • Predict residue networks involved in conformational changes

    • Guide mutagenesis studies by highlighting functionally critical regions

  • Integrative Modeling:

    • Combine low-resolution structural data with computational predictions

    • Incorporate cross-linking and mass spectrometry constraints

    • Refine models iteratively with experimental feedback

These computational approaches should be validated through experimental testing of predictions, particularly through site-directed mutagenesis of predicted functionally important residues.

How can researchers address protein aggregation issues with recombinant pcl1?

Protein aggregation is a common challenge when working with membrane transporters like pcl1. A systematic troubleshooting approach includes:

  • Expression Optimization:

    • Reduce expression temperature to 16-18°C

    • Decrease inducer concentration (0.1-0.2 mM IPTG)

    • Consider specialized E. coli strains (C41/C43) designed for membrane proteins

    • Test different fusion tags beyond His-tag (MBP, SUMO, Trx)

  • Solubilization Strategies:

    • Screen detergent panel (12-15 different detergents) at varied concentrations

    • Test detergent mixtures (e.g., LDAO with cholesterol hemisuccinate)

    • Include stabilizing additives (glycerol, specific lipids, cholesterol)

    • Optimize solubilization time and temperature

  • Purification Refinement:

    • Add imidazole (10-20 mM) in washing buffers to reduce non-specific binding

    • Include metal ions (Mn²⁺ or Fe²⁺) during purification to stabilize structure

    • Use gradient elution rather than step elution

    • Consider on-column refolding protocols

  • Storage Considerations:

    • Determine optimal protein concentration to minimize aggregation

    • Evaluate buffer components' impact on stability

    • Consider lyophilization with 6% trehalose as a stabilizing agent

    • Store working aliquots at 4°C for no more than one week

For analytical assessment of aggregation:

  • Use dynamic light scattering to monitor particle size distribution

  • Perform analytical ultracentrifugation to characterize oligomeric states

  • Employ fluorescence-detection size-exclusion chromatography (FSEC) for pre-crystallization screening

What are the essential controls for assays measuring pcl1-mediated metal transport?

Rigorous controls are critical for accurate measurement of pcl1-mediated metal transport. Researchers should implement the following control measures:

  • Negative Controls:

    • Empty liposomes/vesicles without pcl1

    • Denatured pcl1 (heat-treated or detergent-solubilized)

    • Transport-deficient pcl1 mutants (identified through structure-function analysis)

    • Non-specific transporters of similar size and topology

  • Positive Controls:

    • Well-characterized metal transporters with defined kinetics

    • Ionophores with known metal selectivity (A23187, ionomycin)

    • Chemical gradients to verify vesicle integrity

  • Specificity Controls:

    • Competition assays with varied metal ions

    • Chelator controls (EDTA, EGTA) at defined concentrations

    • pH dependence verification

    • Temperature dependence profiling

  • Technical Validation:

    • Metal concentration verification by ICP-MS

    • Verification of reconstitution efficiency via protein quantification

    • Vesicle size and homogeneity assessment by dynamic light scattering

    • Orientation controls (inside-out vs. right-side-out vesicles)

  • Data Processing Controls:

    • Background subtraction verification

    • Standard curves for all detection methods

    • Technical and biological replicates (minimum n=3 for each)

    • Statistical power analysis to determine adequate sample sizes

A systematic validation matrix should be implemented for each experimental series to ensure reproducibility and accuracy of transport measurements.

How might studies of pcl1 inform our understanding of related human metal transporters?

Studies of pcl1 can significantly contribute to understanding human metal transporters through several research avenues:

  • Evolutionary Relationships:

    • Comparative genomics between pcl1 and human transporters like SPCA1/2, TMEM165, and ferroportin

    • Identification of conserved functional domains across species

    • Tracking evolutionary adaptations in metal coordination sites

  • Structure-Function Translation:

    • Using pcl1 as a simpler model system to study fundamental transport mechanisms

    • Generating chimeric transporters between pcl1 and human homologs

    • Leveraging pcl1 crystallographic data (when available) to model human transporters

  • Disease-Relevant Insights:

    • Modeling human disease mutations in pcl1 to assess functional impacts

    • Investigating how metal transport dysfunction contributes to pathology

    • Screening potential therapeutic compounds using pcl1-based systems

  • Regulatory Mechanisms:

    • Comparing transcriptional and post-translational regulation between yeast and human systems

    • Identifying conserved cellular responses to metal stress

    • Studying protein-protein interactions within metal homeostasis networks

Potential translational applications include:

  • Development of targeted therapies for metal homeostasis disorders

  • Improved biomarkers for conditions involving dysregulated metal transport

  • Novel bioremediation strategies for environmental metal contamination

What emerging technologies could advance our understanding of pcl1 dynamics?

Several cutting-edge technologies hold promise for deepening our understanding of pcl1 dynamics:

  • Cryo-Electron Microscopy:

    • Determination of high-resolution structures in different conformational states

    • Visualization of metal binding sites with single-particle analysis

    • Capturing transporter dynamics during the transport cycle

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Single-molecule FRET to track conformational changes in real-time

    • Correlative light and electron microscopy for contextual structural information

  • Genome Engineering Approaches:

    • CRISPR-Cas9 base editing for precise mutation introduction

    • Inducible degron systems for temporal control of pcl1 expression

    • Optogenetic control of pcl1 activity to study acute responses

  • Proteomics and Interaction Studies:

    • Proximity labeling (BioID, APEX) to map the pcl1 interactome

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Artificial Intelligence Applications:

    • Machine learning prediction of metal specificity determinants

    • Deep learning analysis of transporter sequence-structure-function relationships

    • AI-guided design of pcl1 variants with altered properties

Integration of these technologies with traditional biochemical and cell biological approaches will provide unprecedented insights into the molecular mechanisms of metal transport by pcl1 and related proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.