Recombinant Schizosaccharomyces pombe GDT1-like protein C17G8.08c (SPAC17G8.08c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
SPAC17G8.08c; GDT1-like protein C17G8.08c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC17G8.08c
Target Protein Sequence
MKNPIKWAIIAVLLSTVVAKKIVGEGMADVSAIKHPEEVHPTNRDFLRSLIFSISMIFGC EIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVL FVIFGIKMLMEAKEVMDSKESMSDEFQNVRNEIAANGPIDQLLEEGAAPSHYTGHRSRSG HTLMSQLKSKGRNVMATLFSPLFIKAFALTFVSEWGDRSQIATIAMAASDNVYGVFMGAN VGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFGLVYFYQGFF
Uniprot No.

Target Background

Database Links
Protein Families
GDT1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant S. pombe GDT1-like protein?

For recombinant expression of S. pombe GDT1-like protein, several systems have demonstrated efficiency, though each presents distinct advantages:

E. coli expression systems: While widely used for protein expression, membrane proteins like GDT1-like protein C17G8.08c often present challenges in E. coli due to toxicity, improper folding, or inclusion body formation. If using E. coli, consider these methodological approaches:

  • Use C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Employ fusion tags such as MBP (maltose-binding protein) to enhance solubility

  • Implement low-temperature induction protocols (16-18°C)

Homologous expression in S. pombe: Often preferred for maintaining native post-translational modifications:

  • Use vectors with nmt1 promoter (thiamine-repressible) for controlled expression

  • Consider the pREP series of vectors that allow for various expression levels

  • Implement bulk segregant analysis techniques as demonstrated for other S. pombe proteins to verify expression outcomes

Other yeast systems (S. cerevisiae): Offers a compromise between prokaryotic simplicity and eukaryotic processing:

  • The GAL1 promoter system allows for inducible expression

  • BJ5465 or protease-deficient strains can improve yield of intact protein

When designing expression experiments, researchers should carefully consider how nitrogen starvation or nutrient conditions might affect expression levels, as S. pombe cells undergo significant metabolic shifts under different nutrient conditions, which may impact recombinant protein production .

How should I design experiments to characterize the cellular function of GDT1-like protein C17G8.08c?

Designing experiments to characterize the function of GDT1-like protein C17G8.08c requires a multifaceted approach that combines genetic, biochemical, and cellular techniques:

  • Gene knockout/deletion analysis:

    • Create a deletion strain (SPAC17G8.08c∆) using homologous recombination

    • Perform phenotypic analysis under different stress conditions (calcium, manganese, osmotic stress)

    • Compare growth rates and morphology to wild-type under various conditions

  • Localization studies:

    • Create GFP or other fluorescent protein fusions

    • Use confocal microscopy to determine subcellular localization

    • Perform co-localization studies with known organelle markers

  • Biochemical characterization:

    • Conduct metal ion binding assays to determine affinity for Ca²⁺, Mn²⁺, and other cations

    • Measure transport activity using reconstituted liposomes or vesicles

    • Perform structural studies (crystallography or cryo-EM) if possible

A well-designed experimental plan should include appropriate controls and consider potential confounding variables. For instance, when analyzing phenotypes in a knockout strain, it's crucial to ensure that any observed effects are not due to unintended mutations elsewhere in the genome by implementing complementation assays .

What are the optimal conditions for studying GDT1-like protein interactions with other cellular components?

Studying protein-protein interactions involving GDT1-like protein requires careful consideration of the membrane protein nature:

In vivo approaches:

  • Co-immunoprecipitation (Co-IP): Use mild detergents (0.5-1% digitonin or DDM) to solubilize membranes while maintaining protein-protein interactions

  • Proximity labeling: BioID or APEX2 fusion proteins can identify neighbors in native cellular environments

  • Split-ubiquitin yeast two-hybrid: Specifically designed for membrane protein interactions

In vitro approaches:

  • Pull-down assays: Using purified recombinant protein with appropriate tags

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics with potential interactors

  • Crosslinking mass spectrometry: To capture transient interactions

When designing these experiments, researchers should consider the cell cycle stage of S. pombe, as protein interactions may vary depending on the cell's physiological state. S. pombe expresses one cyclin-dependent kinase (CDK) called Cdc2 and four cyclins that control the cell cycle, and protein interactions may be influenced by these regulatory components . Additionally, nutrient conditions, particularly nitrogen availability, significantly impact S. pombe cell physiology and may affect protein interactions.

How can bulk segregant analysis be applied to study GDT1-like protein C17G8.08c function in S. pombe?

Bulk segregant analysis (BSA) is a powerful genetic mapping technique that can be adapted to study the function of GDT1-like protein C17G8.08c in S. pombe:

Methodology:

  • Cross preparation: Create a cross between a strain with a wild-type SPAC17G8.08c allele and a strain with a mutated version or deletion

  • Phenotype selection: Identify a phenotype associated with the gene function (e.g., calcium sensitivity, growth defects)

  • Pool segregation: Collect and pool segregants displaying either the mutant or wild-type phenotype

  • Genomic analysis: Sequence both pools and identify regions with skewed allele frequencies

  • Validation: Confirm the mapping results through targeted gene modifications

This approach has been successfully applied in S. pombe to map trait-gene relationships, as demonstrated in the mapping of maltose utilization phenotypes . The methodology can be particularly useful when working with complex phenotypes that might be influenced by multiple genetic factors.

Experimental considerations for GDT1-like protein analysis:

  • Consider genomic inversions that might complicate mapping, as such features have been observed in S. pombe strains

  • Account for potential low-complexity regions (LCRs) in the genome during sequence analysis

  • Implement appropriate filtering steps when calling variants to avoid software-specific errors

BSA StepKey ConsiderationsPotential Challenges
Cross preparationEnsure mating compatibilityReduced spore viability if gene affects sexual reproduction
Phenotype selectionChoose easily scorable phenotypePhenotypic overlap or partial penetrance
Pool segregationCollect sufficient segregants (>50)Contamination between pools
Genomic analysisUse multiple variant-calling pipelinesHandling inversions or structural variants
ValidationImplement appropriate controlsOff-target effects in gene editing

What approaches should be used to generate and validate SPAC17G8.08c mutants?

Creating and validating mutants in the SPAC17G8.08c gene requires systematic approaches to ensure specificity and reproducibility:

Generation of mutants:

  • CRISPR-Cas9 system: Now adapted for S. pombe, allows precise genomic editing

    • Design guide RNAs specific to SPAC17G8.08c using S. pombe-optimized tools

    • Include silent mutations in the repair template to prevent re-cutting

  • Homologous recombination: Traditional approach in S. pombe

    • Create gene replacement cassettes with selectable markers

    • Target specific domains based on protein structure prediction

  • Site-directed mutagenesis: For specific amino acid changes

    • Focus on conserved residues identified through multiple sequence alignment

    • Target predicted functional domains (transport, binding sites)

Validation strategies:

  • Genomic PCR: Confirm correct integration and absence of unwanted rearrangements

  • Sequencing: Verify the intended mutation and absence of off-target mutations

  • Transcript analysis: RT-PCR or RNA-seq to confirm expression levels

  • Protein detection: Western blotting to verify protein production (or absence)

  • Complementation tests: Reintroduce wild-type gene to restore function

  • Phenotypic characterization: Compare growth, stress responses, and other relevant phenotypes

When designing mutations, researchers should consider the autoregulating inhibitory feedback loops that characterize many S. pombe regulatory systems, as changes in one component may have cascading effects on cellular physiology .

How does GDT1-like protein C17G8.08c interact with calcium and manganese homeostasis pathways?

Based on homology to GDT1 proteins in other organisms, the S. pombe GDT1-like protein C17G8.08c likely plays a crucial role in calcium and manganese homeostasis. To investigate these interactions:

Experimental approaches for calcium homeostasis studies:

  • Ca²⁺ sensitivity assays: Compare growth of wild-type and mutant strains under varying calcium concentrations

  • Intracellular Ca²⁺ measurements: Use calcium-sensitive fluorescent dyes or genetically encoded calcium indicators (GECIs)

  • Ca²⁺ transport assays: Measure calcium flux in membrane vesicles prepared from cells expressing GDT1-like protein

  • Epistasis analysis: Study genetic interactions with known calcium transporters and regulators in S. pombe

Manganese homeostasis investigation:

  • Mn²⁺ tolerance tests: Assess growth in media with elevated manganese

  • Metal content analysis: Use ICP-MS to quantify cellular manganese levels

  • Transport competition experiments: Determine if manganese competes with calcium for transport

To systematically analyze pathway interactions, consider implementing a conditional expression system where GDT1-like protein levels can be modulated, allowing for temporal analysis of homeostatic responses. This can be achieved using the thiamine-repressible nmt1 promoter system widely used in S. pombe.

What is the relationship between GDT1-like protein function and cell cycle regulation in S. pombe?

Investigating the potential relationship between GDT1-like protein function and cell cycle regulation in S. pombe requires understanding the interconnections between calcium signaling and cell cycle control:

Research approaches:

  • Cell cycle synchronization experiments:

    • Use established methods (nitrogen starvation, hydroxyurea block, etc.) to synchronize cells

    • Monitor GDT1-like protein expression and localization throughout the cell cycle

    • Analyze phenotypes of GDT1-like protein mutants at specific cell cycle stages

  • Integration with known cell cycle regulators:

    • Investigate interactions with the cyclin-dependent kinase Cdc2 and cyclins (Cdc13, Puc1, Cig1, Cig2)

    • Examine potential connections to G1/S transition regulators like Rum1 and MBF complex

    • Study phenotypes in combination with mutations in cell cycle checkpoint genes

S. pombe expresses one cyclin-dependent kinase (Cdc2) and four cyclins to control the cell cycle. Among these, Cig2 is most related to sexual differentiation . Calcium signaling is known to influence multiple cellular processes including cell cycle progression, and GDT1-like proteins may mediate some of these effects through regulation of calcium availability.

Potential connection to nutrient sensing pathways:
The cAMP-PKA pathway and TOR signaling are central to nutrient sensing in S. pombe. Both pathways also influence calcium homeostasis, suggesting potential crosstalk with GDT1-like protein function. Specifically, adenylyl cyclase (Cyr1) generates cAMP from ATP, activating protein kinase A (Pka1) , which might indirectly affect calcium transport systems including GDT1-like proteins.

How can structural biology approaches be optimized for GDT1-like protein C17G8.08c analysis?

Structural characterization of membrane proteins like GDT1-like protein C17G8.08c presents significant challenges but offers invaluable insights into function:

Optimized approaches for structural studies:

  • X-ray crystallography preparation:

    • Use lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Screen detergents extensively (DDM, LMNG, GDN) to identify optimal solubilization conditions

    • Consider fusion partners (e.g., T4 lysozyme) to provide crystal contacts

  • Cryo-electron microscopy (cryo-EM) optimization:

    • Implement nanodiscs or amphipol systems to maintain native-like membrane environment

    • Use Volta phase plates to enhance contrast for smaller membrane proteins

    • Consider implementing multi-dataset particle picking to improve signal-to-noise ratio

  • NMR spectroscopy approaches:

    • For specific domains, consider solution NMR of isolated soluble regions

    • For full-length protein, solid-state NMR can provide insights into membrane-embedded regions

    • Implement selective isotope labeling to reduce spectral complexity

When designing expression constructs for structural studies, careful consideration should be given to the purification tags, linker regions, and potential flexible domains that might hinder crystallization or structural determination. Thermal stability assays can help identify buffer conditions that stabilize the protein for structural studies.

What cutting-edge techniques can be applied to study real-time dynamics of GDT1-like protein in living S. pombe cells?

Investigating the real-time dynamics of GDT1-like protein requires advanced imaging and functional techniques:

Advanced imaging approaches:

  • Single-molecule tracking:

    • Use photoactivatable or photoconvertible fluorescent protein fusions

    • Implement lattice light-sheet microscopy for reduced phototoxicity

    • Analyze diffusion coefficients and confinement zones

  • FRET-based sensors:

    • Design FRET pairs to detect conformational changes during transport

    • Create calcium sensors in proximity to GDT1-like protein to measure local ion concentrations

    • Implement optogenetic tools to trigger calcium release and monitor GDT1-like protein response

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with ultrastructural analysis

    • Map GDT1-like protein distribution relative to membrane subdomains

Functional real-time analysis:

  • Electrophysiological approaches:

    • Patch-clamp techniques adapted for yeast after cell wall removal

    • Reconstitution in lipid bilayers for single-channel recordings

  • Calcium imaging integration:

    • Simultaneous imaging of GDT1-like protein dynamics and calcium fluxes

    • Correlation of protein movement with calcium transients

When implementing these advanced techniques, experimental design should account for S. pombe's cell cycle status and metabolic state, as these can significantly influence protein dynamics and calcium homeostasis. The relationship between nutrient sensing pathways and calcium signaling should also be considered, as starvation responses in S. pombe activate specific signaling cascades that may affect GDT1-like protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.