Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp38 (tvp38)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vesicular Trafficking

Tvp38 is a transmembrane protein localized to the Tlg2-containing Golgi subcompartment and endosomes . While non-essential for yeast viability under standard conditions , it plays a role in:

  • Membrane integrity: Stabilizing Golgi and endosomal membranes through interactions with Yip-family proteins (Yip4, Yip5) .

  • Vesicle organization: Potential involvement in cargo selection or vesicle budding, inferred from co-localization with SNARE proteins like Tlg2 .

  • Evolutionary conservation: Homologs in humans, plants (e.g., Arabidopsis thaliana Atlg22850), and bacteria share structural motifs linked to membrane-associated processes .

Key Studies on Tvp38

  1. Proteomic Identification:

    • Tvp38 was first identified in Saccharomyces cerevisiae Golgi subcompartments via immunoisolation with Tlg2, a late Golgi/endosomal SNARE .

    • Localization studies confirmed its presence in Tlg2-marked membranes, distinct from early Golgi markers like Sed5 .

  2. Functional Insights:

    • Disruption of tvp38 in yeast did not impair carboxypeptidase Y or alkaline phosphatase processing, suggesting redundant roles in secretory pathways .

    • Synthetic genetic interactions with ypt6 (Rab GTPase) and ric1 (Golgi-ER retrograde transport) mutants hint at roles in vesicle tethering or fusion .

  3. Conserved Domains:

    • The DedA domain, present in bacterial and chloroplast homologs, includes transmembrane helices and a cytoplasmic loop critical for membrane stabilization .

    • Structural modeling predicts dimerization via conserved glycine residues .

Applications and Research Utility

Recombinant Tvp38 is primarily used to:

  • Study membrane protein trafficking mechanisms in fission yeast and cross-species homologs .

  • Investigate the DedA protein family’s role in organelle membrane dynamics (e.g., thylakoid biogenesis in chloroplasts) .

  • Serve as an antigen in ELISA assays for protein interaction studies .

Comparative Analysis of Tvp38 Homologs

OrganismProtein NameLocalizationFunction
S. pombeTvp38Golgi/endosomesMembrane stabilization
Escherichia coliDedAPlasma membraneLipid homeostasis
Arabidopsis thalianaAtlg22850ChloroplastThylakoid membrane organization
Homo sapiensTMEM165GolgiGlycosylation defects in mutants

Future Directions

Current gaps include:

  • Mechanistic clarity: Direct evidence for Tvp38’s role in cargo sorting or vesicle formation remains elusive .

  • Chloroplast studies: Functional characterization of plant homologs could link Tvp38/DedA proteins to thylakoid biogenesis .

  • Structural biology: High-resolution structures are needed to define oligomerization and motif functions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
tvp38; SPBC1711.09c; Golgi apparatus membrane protein tvp38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
tvp38
Target Protein Sequence
MPAPIALAAIGILIVVFAILLAVFHNDLLAIAMPIAERIAKLPMSFLIALVLIAASSIPP LLGQDPLALLIGAVWGLNVGFWTVVCGIFIGETIAFMAYRYFLEQKAQEFREHHEEHYGT FVKIVEEGSYPLIWLIRLSFLPTHFTTVFFATLPELSYIGWAIAFWLSCFKYLVPVYAGY CIVHNKSSAANIVGIVLSIVVTLGTLAFLIVRYKAIKNSTLEDSTNSTSDVLNHLESQPT DSIDLRHLEQTSEQNETDNSERKHLLSHQH
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is tvp38 and what is its fundamental role in Schizosaccharomyces pombe?

Tvp38 stands for Tlg2-compartment vesicle protein of 38 kDa, first identified in a proteomic analysis of Saccharomyces cerevisiae Golgi subcompartment membrane fractions defined by the vesicle-fusion protein Tlg2 . In Schizosaccharomyces pombe, tvp38 functions as a membrane-integral protein involved in vesicular trafficking processes. Although not essential for growth under laboratory conditions, tvp38's co-localization with other proteins involved in vesicular membrane trafficking suggests its important function in membrane transport processes .

The protein appears to be specifically involved in cargo selection during vesicle formation at the Golgi membrane, contributing to the organization of vesicular structures . Research indicates that tvp38 plays a role in maintaining membrane integrity and organization, particularly in the context of the Golgi apparatus and potentially in other membrane systems .

How is tvp38 evolutionarily conserved across different species?

Tvp38 represents a highly conserved protein family with homologs present across multiple kingdoms. Phylogenetic analysis reveals that tvp38 homologs are found in:

  • Fungi (including Saccharomyces cerevisiae and Schizosaccharomyces pombe)

  • Higher eukaryotes (including humans)

  • Prokaryotes (where they belong to the DedA protein family)

  • Chloroplasts of plants

  • Cyanobacteria

This conservation suggests fundamental importance in cellular processes. Interestingly, while chloroplasts contain only a single tvp38 homolog, cyanobacterial genomes typically encode multiple homologous proteins . The Arabidopsis thaliana tvp38 homolog contains an N-terminal chloroplast targeting sequence, confirming its localization within chloroplasts .

The evolutionary relationships among these homologs can be visualized in phylogenetic analyses, revealing distinct clustering patterns. For instance, the Prochlorococcus marinus MED4 tvp38/DedA-homolog PMM0308 clusters together with eukaryotic tvp38 proteins of the secretory pathway, suggesting similar physiological functions .

What are the structural characteristics of tvp38 protein?

Tvp38 is a transmembrane protein with distinct structural characteristics:

OrganismProtein FeatureDetails
S. pombeLengthTypically ~200-220 amino acids
S. pombeTransmembrane domainsMultiple transmembrane helices (4-5)
S. pombeStructural motifsContains a canonical LeuT-fold domain
CyanobacteriaTransmembrane predictionSlr0232 and Slr0305: 5 transmembrane helices; Slr0509: 4 predicted transmembrane helices

The DedA protein family, to which bacterial tvp38 homologs belong, is characterized by a conserved domain with a canonical LeuT-fold predicted by computational methods . This fold consists of two repeats of a five-transmembrane helix domain, forming a structure found in many functional transport proteins, such as bacterial homologs of sodium-dependent neurotransmitter transporters .

While the exact three-dimensional structure has not been fully elucidated, these transmembrane domains appear critical for proper membrane insertion and function. The protein likely adopts a conformation that facilitates interaction with membrane lipids and potentially with other proteins involved in vesicular trafficking .

What experimental approaches are most effective for studying tvp38 localization and function?

To effectively study tvp38 localization and function, researchers should consider multiple complementary approaches:

  • Subcellular Fractionation and Proteomic Analysis: The original identification of tvp38 was achieved through proteomic analysis of Golgi subcompartment membrane fractions . This approach remains valuable for initial localization studies, especially when coupled with mass spectrometry for protein identification. Researchers should use differential centrifugation techniques optimized for membrane proteins, followed by gradient centrifugation to separate various membrane compartments.

  • Fluorescence Microscopy with Tagged Constructs: Generating recombinant tvp38 fused with fluorescent proteins (GFP, mCherry) enables live-cell visualization of its localization. Co-localization studies with known Golgi markers provide valuable insights into the specific subcompartments where tvp38 resides. Time-lapse microscopy can reveal dynamic trafficking events involving tvp38-positive structures.

  • Immunolocalization Techniques: Using specific antibodies against tvp38, such as the polyclonal antibody described in the Cusabio datasheet , researchers can perform immunofluorescence or immunoelectron microscopy to determine precise subcellular localization at high resolution. For S. pombe studies, the CSB-PA885844XA01SXV antibody raised against recombinant S. pombe tvp38 protein provides a valuable tool for Western blot and ELISA applications .

  • Gene Deletion/Knockout Studies: While tvp38 is not essential for growth under laboratory conditions in yeast , generating knockout strains enables the assessment of subtle phenotypes under various stress conditions. Researchers should examine membrane organization, vesicular trafficking rates, and cargo selection in these mutants.

  • Complementation Assays: Expression of tvp38 homologs from different species in a tvp38-knockout background can reveal functional conservation and species-specific adaptations. This approach is particularly valuable for studying the functional equivalence of DedA family proteins from bacteria and tvp38 from eukaryotes .

How do post-translational modifications affect tvp38 function in membrane trafficking?

While specific post-translational modifications (PTMs) of tvp38 have not been extensively characterized in the provided search results, this represents an important area for investigation based on our understanding of membrane trafficking proteins. Research approaches should include:

  • Phosphorylation Analysis: Many membrane trafficking proteins are regulated by phosphorylation. Mass spectrometry analysis of immunoprecipitated tvp38 under various cellular conditions can reveal phosphorylation sites. Researchers should generate phosphomimetic and phospho-dead mutants to assess the functional impact of these modifications on vesicle formation and cargo selection.

  • Ubiquitination Studies: Ubiquitination often regulates protein stability and trafficking. Western blot analysis with anti-ubiquitin antibodies on immunoprecipitated tvp38 can reveal whether this modification occurs. Proteasome inhibitors can be used to determine if tvp38 turnover is regulated by the ubiquitin-proteasome system.

  • Glycosylation Analysis: As a Golgi-resident protein, tvp38 might undergo glycosylation. Researchers should employ glycosidase treatments followed by mobility shift assays to detect glycosylation. Site-directed mutagenesis of potential glycosylation sites can determine their functional significance.

  • Protein-Protein Interaction Studies: PTMs often mediate protein-protein interactions. Techniques such as cross-linking mass spectrometry, proximity labeling (BioID, APEX), and co-immunoprecipitation can identify tvp38 interaction partners that may be regulated by or regulate tvp38 PTMs.

Understanding these modifications will provide insights into how tvp38 function is dynamically regulated in response to cellular needs for vesicular trafficking and membrane organization .

What is the relationship between tvp38 and thylakoid membrane biogenesis in chloroplasts and cyanobacteria?

The presence of tvp38 homologs in chloroplasts and cyanobacteria suggests an intriguing functional connection to thylakoid membrane biogenesis and maintenance . Several lines of evidence support this relationship:

  • Differential Distribution in Photosynthetic Organisms: Chloroplasts contain a single tvp38 homolog, while cyanobacteria typically encode multiple homologous proteins, suggesting specialized roles in these photosynthetic systems . Notably, only Gloeobacter violaceus PCC 7421, a cyanobacterium lacking internal thylakoid membranes, does not possess a homolog of the Synechocystis Slr0305 protein, functionally linking tvp38-like proteins to thylakoid membranes .

  • Potential Roles in Membrane Architecture: The tvp38/DedA family proteins appear involved in maintaining the integrity and architecture of internal membranes. In chloroplasts and cyanobacteria, these proteins may stabilize thylakoid membrane structures or mediate lipid/protein transport between envelope membranes and thylakoids .

  • Experimental Approaches for Investigation: Researchers should employ the following strategies to elucidate this relationship:

    • Membrane fractionation to determine the precise localization of tvp38 homologs within chloroplast/cyanobacterial membrane systems

    • Electron microscopy analysis of thylakoid ultrastructure in tvp38 mutants

    • Lipidomic analysis to detect changes in membrane lipid composition

    • In vitro vesicle formation assays using purified components to test direct involvement in membrane dynamics

  • Vesicular Trafficking in Thylakoid Biogenesis: While classical vesicular trafficking components are not well-characterized in chloroplasts/cyanobacteria, tvp38 homologs may participate in as-yet-undefined vesicle transport mechanisms between inner envelope/cytoplasmic membranes and thylakoid membranes . This would parallel the role of Tvp38 in vesicle formation in the late Golgi compartment of eukaryotes.

How can recombinant tvp38 be optimally expressed and purified for structural studies?

Optimizing expression and purification of recombinant tvp38 for structural studies presents several challenges due to its multiple transmembrane domains. A systematic approach should include:

  • Expression System Selection:

    • For bacterial expression, consider specialized E. coli strains designed for membrane proteins (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Yeast expression systems (Pichia pastoris) may provide better folding for eukaryotic tvp38

    • Cell-free systems with appropriate detergents can be used for direct solubilization during synthesis

  • Construct Design Optimization:

    • Include affinity tags (His6, FLAG, Strep-II) positioned to avoid interference with membrane insertion

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Generate truncated constructs focusing on specific domains for crystallization attempts

    • For structural studies of S. pombe tvp38, use the full-length sequence identified in proteomic analyses

  • Solubilization and Purification Strategy:

StageMethodConsiderations
Membrane ExtractionDetergent screeningTest DDM, LMNG, CHAPS, Digitonin
Affinity PurificationIMAC or other affinity methodsUse detergent in all buffers
Secondary PurificationSize exclusion chromatographyAssess monodispersity
Stability AssessmentThermal shift assaysOptimize buffer conditions
Structural AnalysisCrystallography, Cryo-EM, or NMRMethod depends on stability and yield
  • Reconstitution Methods: For functional studies, reconstitution into proteoliposomes allows assessment of potential transport activities. Researchers should consider:

    • Lipid composition mimicking native membrane environment

    • Reconstitution techniques (detergent removal by dialysis or Bio-Beads)

    • Assays to measure membrane integrity and potential transport functions

The recombinant protein should be validated using techniques such as circular dichroism to confirm proper folding and Western blotting with specific antibodies like the Cusabio CSB-PA885844XA01SXV antibody .

What are the key considerations when designing antibodies against tvp38 for research applications?

When designing antibodies against tvp38 for research applications, several critical factors must be considered:

  • Antigen Selection and Design:

    • Recombinant full-length protein: As used in the Cusabio antibody (CSB-PA885844XA01SXV), using recombinant Schizosaccharomyces pombe tvp38 protein as the immunogen provides recognition of the native protein

    • Peptide antigens: Select unique, surface-exposed regions that are not within transmembrane domains

    • Consider species-specificity requirements: The high conservation of tvp38 across species may result in cross-reactivity, which can be either desirable or problematic depending on research goals

  • Antibody Type Selection:

    • Polyclonal antibodies (like Cusabio's product) provide recognition of multiple epitopes, enhancing detection sensitivity but potentially increasing background

    • Monoclonal antibodies offer higher specificity for particular epitopes, beneficial for distinguishing between closely related homologs

    • Consider application requirements: Western blotting requires recognition of denatured epitopes, while immunoprecipitation requires native epitope recognition

  • Validation Strategy:

    • Use tvp38 knockout/knockdown controls to confirm specificity

    • Test cross-reactivity with homologs from different species if studying evolutionary relationships

    • Validate across multiple applications (WB, IF, IP, ELISA) as needed

    • For subcellular localization studies, co-localization with known Golgi markers is essential

  • Storage and Handling:

    • Follow manufacturer recommendations such as those for the Cusabio antibody (storage at -20°C or -80°C, avoiding repeated freeze-thaw cycles)

    • Use appropriate preservatives (e.g., 0.03% Proclin 300) and stabilizers (e.g., 50% Glycerol) in storage buffers

    • Validate antibody performance after long-term storage

How can researchers effectively study the interaction network of tvp38?

Understanding tvp38's interaction network is crucial for elucidating its function in membrane trafficking. Researchers should employ multiple complementary approaches:

  • Proximity-Based Approaches:

    • BioID/TurboID: Fusing tvp38 with a biotin ligase enables biotinylation of proximal proteins, which can be isolated using streptavidin and identified by mass spectrometry

    • APEX2 proximity labeling: Similar to BioID but with shorter labeling times, providing temporal resolution of interactions

    • These methods are particularly valuable for membrane proteins like tvp38, as they capture transient interactions in the native cellular environment

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Generate stable cell lines expressing tagged tvp38 (FLAG, HA, or Strep-II tags)

    • Optimize membrane solubilization conditions to preserve interactions

    • Use quantitative proteomics approaches (SILAC, TMT) to distinguish specific from non-specific interactions

    • Include appropriate controls (tag-only, unrelated membrane protein)

  • Genetic Interaction Mapping:

    • Synthetic genetic array (SGA) analysis in yeast to identify genes that show synthetic lethality or suppression with tvp38 mutations

    • CRISPR-based screens to identify genetic interactions in mammalian cells

    • These approaches can reveal functional relationships even in the absence of direct physical interactions

  • Co-localization Studies:

    • Multi-color live-cell imaging to assess co-localization with known vesicle trafficking components

    • Super-resolution microscopy techniques (STED, PALM, STORM) to visualize potential interactions at the nanoscale

    • Fluorescence resonance energy transfer (FRET) to detect direct protein-protein interactions in live cells

  • Functional Validation:

    • Mutagenesis of putative interaction interfaces to disrupt specific interactions

    • Heterologous reconstitution systems to test direct interactions in controlled environments

    • Assess the impact of disrupting specific interactions on vesicular trafficking processes

What techniques are most effective for analyzing tvp38 function in vesicular trafficking?

To effectively analyze tvp38 function in vesicular trafficking, researchers should employ multiple complementary approaches:

  • Cargo Trafficking Assays:

    • Pulse-chase experiments with fluorescently labeled cargo proteins

    • Quantitative analysis of trafficking kinetics in wild-type versus tvp38-deficient cells

    • Live-cell imaging of fluorescent protein-tagged cargo to track movement through the secretory pathway

    • RUSH (Retention Using Selective Hooks) system to synchronize cargo release for temporal resolution of trafficking events

  • Vesicle Isolation and Characterization:

    • Differential and density gradient centrifugation to isolate specific vesicle populations

    • Immunoisolation of tvp38-positive vesicles using antibodies like the Cusabio CSB-PA885844XA01SXV

    • Proteomic analysis of isolated vesicles to identify cargo and machinery components

    • Electron microscopy of isolated vesicles to characterize morphology and size distribution

  • In Vitro Reconstitution:

    • Cell-free vesicle budding assays using purified components

    • Liposome-based systems to test direct effects of tvp38 on membrane curvature or fusion

    • Microfluidic approaches to visualize vesicle formation in real-time

    • Assessment of cargo selection mechanisms using purified components

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy to visualize vesicle formation events below the diffraction limit

    • Correlative light and electron microscopy (CLEM) to combine functional data with ultrastructural information

    • Single-molecule tracking to follow individual tvp38 molecules in the membrane

    • Fluorescence recovery after photobleaching (FRAP) to measure membrane protein dynamics

  • Computational Modeling:

    • Molecular dynamics simulations of tvp38 in membrane environments

    • Systems biology approaches to integrate experimental data into network models

    • Predictive modeling of vesicle formation based on membrane composition and protein interactions

What are the major unresolved questions regarding tvp38 function across different species?

Despite progress in understanding tvp38, several critical questions remain unresolved:

  • Precise Molecular Function: While tvp38 is implicated in vesicular trafficking and membrane organization, its exact molecular mechanism remains elusive . Does it function as:

    • A cargo adaptor recognizing specific sorting signals?

    • A structural component stabilizing membrane curvature?

    • A regulator of membrane fusion events?

    • A transporter of specific lipids or small molecules across membranes?

  • Functional Divergence Across Species: The presence of tvp38 homologs across diverse organisms raises questions about functional specialization:

    • How have tvp38 functions evolved from prokaryotes to eukaryotes?

    • Why do cyanobacteria typically encode multiple tvp38 homologs while chloroplasts contain only one?

    • What selective pressures drive the conservation of tvp38 across such diverse lineages?

  • Integration with Membrane Trafficking Machinery: How tvp38 interfaces with the canonical vesicle trafficking machinery remains poorly understood:

    • Does tvp38 interact directly with SNARE proteins or other fusion machinery?

    • How is tvp38 activity regulated in response to cellular needs?

    • Is tvp38 involved in specific trafficking routes or general membrane homeostasis?

  • Role in Disease and Stress Responses: The potential involvement of tvp38 in cellular stress responses and pathological conditions requires investigation:

    • How do tvp38 mutations or expression changes affect cellular physiology?

    • Are tvp38 homologs in humans implicated in disease states?

    • How do tvp38-family proteins respond to environmental stressors?

Future research should employ integrative approaches combining structural biology, advanced imaging, and systems-level analyses to address these questions .

How can comparative studies of tvp38 across species inform our understanding of eukaryotic membrane trafficking evolution?

Comparative studies of tvp38 across species represent a powerful approach to understanding the evolution of membrane trafficking systems:

  • Evolutionary Trajectory Analysis: The presence of tvp38/DedA proteins in both prokaryotes and eukaryotes provides an opportunity to trace the evolutionary history of membrane organization systems . Researchers should:

    • Perform comprehensive phylogenetic analyses across diverse species

    • Correlate protein sequence/structure changes with organism complexity

    • Identify conserved functional motifs versus lineage-specific adaptations

  • Functional Conservation Testing: Complementation experiments across species boundaries can reveal functional conservation:

    • Express human tvp38 homologs in yeast tvp38 mutants to test functional rescue

    • Introduce cyanobacterial tvp38 homologs into chloroplasts to assess functional equivalence

    • Use chimeric proteins combining domains from different species to map functional regions

  • Comparative Structural Biology: Structural comparisons across homologs can reveal evolutionary constraints:

    • Determine high-resolution structures of tvp38 proteins from diverse lineages

    • Map conservation patterns onto structural models

    • Identify structural adaptations coinciding with new cellular functions

  • Correlation with Membrane Complexity: The organization of tvp38 genes correlates with membrane system complexity:

    • Gloeobacter violaceus, lacking thylakoid membranes, also lacks certain tvp38 homologs

    • Organisms with more complex endomembrane systems often show expanded tvp38 gene families

    • This pattern suggests co-evolution of tvp38 with membrane organization complexity

  • Reconstruction of Ancestral Functions: Computational reconstruction of ancestral tvp38 sequences, combined with experimental characterization, can reveal the original functions of this protein family and how they diversified during evolution .

These comparative approaches will provide insights not only into tvp38 function but also into the broader evolutionary history of membrane trafficking systems from prokaryotes to complex eukaryotes.

What potential biotechnological applications could emerge from better understanding tvp38 function?

Enhanced understanding of tvp38 function could enable several biotechnological applications:

  • Engineered Vesicular Delivery Systems:

    • Designing synthetic vesicles with modified tvp38 proteins for targeted delivery of therapeutic cargo

    • Engineering tvp38-based systems for controlled release of compounds in industrial fermentation

    • Developing cellular models with modified tvp38 to study trafficking defects in disease states

  • Enhanced Protein Production Platforms:

    • Optimizing secretory pathway efficiency in industrial protein production by modulating tvp38 expression

    • Creating yeast or mammalian cell lines with engineered tvp38 for improved production of secreted recombinant proteins

    • Developing screening platforms to identify compounds that modulate vesicular trafficking for therapeutic purposes

  • Biosensors for Membrane Dynamics:

    • Generating tvp38-based biosensors to monitor vesicle formation and trafficking in real-time

    • Creating high-throughput screening systems to identify modulators of membrane dynamics

    • Developing diagnostic tools to detect abnormal membrane trafficking in pathological samples

  • Enhanced Chloroplast Engineering:

    • Modifying chloroplast tvp38 homologs to improve thylakoid membrane organization for enhanced photosynthetic efficiency

    • Engineering cyanobacterial tvp38 proteins to optimize biofuel production in photosynthetic platforms

    • Developing tools for targeted delivery of proteins to specific compartments within chloroplasts

  • Membrane Protein Production Systems:

    • Utilizing tvp38's role in membrane organization to develop improved expression systems for challenging membrane proteins

    • Creating specialized lipid environments for structural studies of membrane proteins

    • Designing stable cell lines with optimized membrane composition for pharmaceutical screening

These applications would build upon fundamental research into tvp38 function while addressing significant biotechnological challenges in drug delivery, protein production, and engineered biological systems.

What are the most common technical challenges when working with recombinant tvp38 and how can they be addressed?

Researchers working with recombinant tvp38 frequently encounter several technical challenges:

How can researchers address data interpretation challenges when studying tvp38 function?

Data interpretation when studying tvp38 function presents several unique challenges that require careful consideration:

  • Distinguishing Direct vs. Indirect Effects:

    • Challenge: Membrane perturbations can have wide-ranging downstream effects

    • Solutions:

      • Design acute inactivation systems (e.g., auxin-inducible degron tags) to examine immediate consequences

      • Use structure-guided mutations targeting specific functions rather than complete gene deletions

      • Perform rescue experiments with wild-type and mutant versions to establish causality

      • Combine genetic approaches with biochemical isolation to establish direct interactions

  • Functional Redundancy:

    • Challenge: Multiple tvp38 homologs, particularly in cyanobacteria, may have overlapping functions

    • Solutions:

      • Generate combination knockouts of multiple family members

      • Use comparative analysis across species with different numbers of homologs

      • Perform domain-swapping experiments to identify functional specializations

      • Conduct comprehensive interaction mapping to identify shared and unique partners

  • Phenotype Subtlety:

    • Challenge: tvp38 is not essential in yeast under laboratory conditions, suggesting subtle or condition-specific roles

    • Solutions:

      • Test growth and trafficking under various stress conditions

      • Employ high-sensitivity quantitative assays rather than qualitative observations

      • Look for synthetic phenotypes with mutations in related pathways

      • Use systems-level approaches (transcriptomics, proteomics) to detect compensatory mechanisms

  • System-Specific Variations:

    • Challenge: tvp38 function may vary significantly across experimental systems

    • Solutions:

      • Always include system-appropriate controls

      • Avoid direct extrapolation between distant species without experimental validation

      • Consider membrane composition differences when interpreting localization or functional data

      • Use consistent experimental conditions when making comparative analyses

  • Integration with Existing Knowledge:

    • Challenge: Placing tvp38 function in the context of well-established trafficking pathways

    • Solutions:

      • Systematically test interactions with canonical trafficking components

      • Map tvp38 function to specific trafficking steps using synchronized cargo systems

      • Integrate findings with computational models of membrane trafficking

      • Consider evolutionary context when interpreting functional data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.