Recombinant Schizosaccharomyces pombe GPI mannosyltransferase 3 (gpi10)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Schizosaccharomyces pombe GPI mannosyltransferase 3 (gpi10) is a key enzyme in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors, which are essential for tethering proteins to cell membranes. This enzyme catalyzes the transfer of the first α1,4-linked mannose to the GlcN-acyl-phosphatidylinositol (GlcN-acyl-PI) intermediate during GPI anchor assembly . Produced via recombinant DNA technology in systems such as E. coli, yeast, or mammalian cells , gpi10 is critical for fungal cell wall integrity, viability, and protein localization .

Gene and Protein Structure

  • Gene Name: gpi10 (also termed pig-B in predictive models) .

  • Protein: GPI mannosyltransferase 3 (GPI-MT-I), a multi-pass transmembrane endoplasmic reticulum (ER) protein .

  • Domains: Contains conserved regions for dolichol-phosphate-mannose (Dol-P-Man) binding and catalytic activity .

Table 1: Key Molecular Features

FeatureDetail
OrganismSchizosaccharomyces pombe
UniProt IDQ2UH15 (Aspergillus oryzae homolog)
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE)
Protein Length (Recombinant)Partial (specific residues not fully detailed in available data)

Functional Role in GPI Biosynthesis

Gpi10 is a component of the GPI-mannosyltransferase I (GPI-MT-I) complex, which initiates GPI anchor assembly:

  1. Catalytic Function: Transfers the first mannose from Dol-P-Man to GlcN-acyl-PI .

  2. Complex Formation: Requires stabilization by PIG-X (in mammals) or Pbn1p (in yeast) for enzymatic activity .

  3. Essentiality: Gene disruption in S. pombe leads to defective GPI anchors, impaired cell separation, and loss of viability .

Recombinant Expression and Purification

Recombinant gpi10 is produced in heterologous systems with the following parameters:

  • Host Flexibility: Optimized for E. coli, yeast, and mammalian cells to ensure proper post-translational modifications .

  • Tagging: Often fused with His tags for affinity purification .

  • Yield: High-purity (>90%) preparations achievable via lyophilization .

Table 2: Expression Systems and Applications

Host SystemAdvantagesApplications
E. coliCost-effective, high yieldStructural studies, inhibitor assays
YeastEukaryotic folding, glycosylation supportFunctional genomics
Mammalian CellsNative-like post-translational modificationsTherapeutic protein research

Genetic and Functional Studies

  • Essential Gene: gpi10 knockout in S. pombe results in lethality due to disrupted GPI anchoring, affecting cell wall integrity and morphology .

  • Rescue Experiments: Human PIG-B complements S. cerevisiae gpi10Δ, confirming functional conservation .

  • Drug Target Potential: GPI biosynthesis inhibitors (e.g., YW3548) show reduced efficacy in GPI10-overexpressing strains, implicating it in antifungal resistance .

Applications in Biotechnology and Medicine

  • Cell Engineering: Used to study GPI-anchored protein trafficking in S. pombe .

  • Therapeutic Development: Target for antifungal and antiparasitic agents due to its essential role in pathogens .

  • Industrial Protein Production: Overexpression of GPI-anchored proteins in S. pombe och1Δ mutants improves cell growth and recombinant protein yields .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
gpi10; SPCC16A11.06c; GPI mannosyltransferase 3; GPI mannosyltransferase III; GPI-MT-III; Glycosylphosphatidylinositol-anchor biosynthesis protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-506
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
gpi10
Target Protein Sequence
MRIWFWLAILVFRWWNALWVKTFFQPDEFYQSLEVAHHFIFRYGFLTWEWTSAIRSALHP LIFAALYRVLQVLKLDSSYFVFTNAPKLLQGTFAAILDYGTYKFALVRYGSKTANWTLAC SLVSIMNAYVGVRTFSNSLETTLTSIGFYYFSYYLKYENSSPEQRKKAYSSLLGFISVAA FACFIRPTNILVWIFPLLFWNKNPQTPIKDLLSFSNVFNRFRFLYALGYGRLFGIFVLCV SLFLVNIIADRILYGRFVFPIISFFQFNVTSGLSSLYGLNAWHYYLSQALPLICGGFLPF VLLTMDLQTAGTILCVFFPYSLIGHKELRFVYPISPILLTLAGKFFSSFSSWKRAARFFF LIGLGHALVITFLCRFHQFGVMEVMPLIHSLAEKNQTGLILAPCHTTPWQSHIHSPFAEN GWKFLTCEPFEKPFDETDRFYENMPTFLDKIKEWPDYLIFFEERFYSLYSYLDSRGLKYE EVQRYYNSLIPESRERAGALLVYKKL
Uniprot No.

Target Background

Function
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Catalyzes the transfer of the third mannose residue to Man2-GlcN-acyl-PI during GPI precursor assembly.
Database Links
Protein Families
Glycosyltransferase 22 family, PIGB subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of GPI mannosyltransferase 3 (gpi10) in S. pombe?

GPI mannosyltransferase 3 (gpi10) is an essential enzyme in the glycosylphosphatidylinositol (GPI) anchor biosynthesis pathway in Schizosaccharomyces pombe. It catalyzes the addition of the third mannose (Man-3) to the GPI intermediate during anchor assembly . This enzyme plays a crucial role in the biosynthesis of GPI-anchored proteins, which are ultimately attached to the cell wall and plasma membrane. The GPI anchor serves as a mechanism to tether proteins to the cell surface, contributing to cell wall integrity and cellular interactions in fission yeast. The complete functional GPI anchor in S. pombe consists of a complex structure that includes multiple mannose residues and ethanolaminephosphate (EtNP) groups, with gpi10 specifically responsible for the addition of the third mannose residue in this structure .

How does the protein structure of S. pombe gpi10 correlate with its enzymatic function?

S. pombe gpi10 (UniProt ID: Q9USN0) is a membrane protein with multiple transmembrane domains that facilitate its localization to the endoplasmic reticulum, where GPI biosynthesis occurs . The protein consists of 506 amino acids and contains specific domains responsible for its mannosyltransferase activity . Key structural features include:

  • Multiple hydrophobic transmembrane regions that anchor the protein in the ER membrane

  • Conserved catalytic domains responsible for mannose transfer

  • Regions that mediate interactions with other components of the GPI biosynthesis machinery

The protein's structure includes conserved motifs that are characteristic of glycosyltransferases, which align with its function of transferring mannose from donor molecules to the growing GPI anchor intermediate. The presence of multiple transmembrane domains is consistent with the enzyme's role in processing a lipid-linked substrate that is embedded in the ER membrane .

What experimental approaches are effective for studying gpi10 gene expression in S. pombe?

When investigating gpi10 gene expression in S. pombe, several complementary approaches yield comprehensive results:

  • RT-qPCR Analysis: This technique provides quantitative measurement of gpi10 mRNA levels under various conditions. For optimal results, researchers should:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Normalize expression against at least three stable reference genes (act1+, cdc2+, and pda1+)

    • Include appropriate negative controls (no reverse transcriptase)

  • Northern Blot Analysis: This approach allows visualization of transcript size and integrity. Similar to the techniques used for alpha-1 antitrypsin expression analysis in S. pombe, 32P-labeled probes can be designed specifically for gpi10 transcripts .

  • RNA-Seq: This provides a genome-wide context for gpi10 expression and can reveal co-regulated genes in the GPI biosynthesis pathway.

  • Promoter-Reporter Fusion Assays: By fusing the gpi10 promoter region to reporter genes (like GFP or lacZ), the regulation of gene expression can be monitored under different conditions.

The expression pattern of gpi10 can be compared with other genes involved in cell wall integrity and glycosylation pathways to understand its regulatory context within the broader cellular processes.

What are the optimal conditions for recombinant expression and purification of S. pombe gpi10?

Recombinant expression and purification of S. pombe gpi10 presents significant challenges due to its multiple transmembrane domains. Based on available research, the following methodological approach is recommended:

Expression System Selection:

  • For functional studies, a eukaryotic expression system is preferable to maintain proper folding and post-translational modifications

  • S. pombe itself can be used as an expression host, utilizing the strong ADH promoter as demonstrated for other recombinant proteins

  • For structural studies, consider using Pichia pastoris, which provides high expression levels while maintaining proper eukaryotic protein processing

Expression Optimization:

  • Construct design should include:

    • N-terminal or C-terminal affinity tags (6xHis or FLAG) for purification

    • TEV protease cleavage site for tag removal

    • Potential inclusion of a solubility-enhancing fusion partner (MBP or SUMO)

  • Growth conditions:

    • Optimal temperature: 28-30°C for S. pombe expression

    • Media: EMM (Edinburgh Minimal Medium) with appropriate selection

    • Induction parameters: For constitutive promoters like ADH, no induction is required, but for inducible systems, optimize inducer concentration and timing

Purification Strategy:

  • Membrane preparation:

    • Cell disruption using glass beads or enzymatic methods

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using detergents (start with 1% DDM, LMNG, or GDN)

  • Chromatography sequence:

    • Initial capture: IMAC (Immobilized Metal Affinity Chromatography) for His-tagged proteins

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Quality control:

    • SDS-PAGE with western blotting using anti-tag or specific anti-gpi10 antibodies

    • Mass spectrometry for identity confirmation

    • Thermostability assays to assess proper folding

This methodological framework addresses the challenging nature of membrane protein purification while maintaining the protein in a native-like, functional state.

How can CRISPR-Cas9 be applied to modify gpi10 in S. pombe for functional studies?

CRISPR-Cas9 genome editing provides powerful tools for manipulating gpi10 in S. pombe. The following protocol outlines a comprehensive approach:

sgRNA Design and Cloning:

  • Identify target sites within the gpi10 gene using S. pombe-specific CRISPR tools

  • Design sgRNAs with minimal off-target effects (typically 20 nucleotides)

  • Clone sgRNAs into an expression vector containing the S. pombe U6 promoter

  • Include a repair template for precise modifications:

    • For point mutations: 60-80 bp homology arms on each side

    • For insertions/deletions: longer homology arms (200-500 bp)

Transformation and Selection:

  • Transform S. pombe cells with:

    • Cas9 expression plasmid (under nmt1 promoter)

    • sgRNA expression construct

    • Repair template (linear or plasmid-based)

  • Select transformants using appropriate markers

  • Verify edits by PCR amplification and sequencing

Functional Verification Methods:

  • Growth phenotype analysis under various conditions

  • Cell wall integrity assays using β-glucanase sensitivity tests

  • Fluorescence microscopy for localization studies (if tagged versions are created)

  • Proteomic analysis of GPI-anchored proteins

This approach enables precise genetic manipulation of gpi10 to create specific mutations for structure-function studies, conditional alleles, or reporter fusions for localization studies.

What methods can effectively assess the impact of gpi10 modifications on GPI-anchored protein production?

Evaluating how gpi10 modifications affect GPI-anchored protein production requires multi-faceted analysis:

Quantitative Protein Analysis:

  • Western blotting with specific antibodies against model GPI-anchored proteins

  • Mass spectrometry-based proteomics to identify and quantify the global GPI proteome

  • ELISA assays for secreted or cell-surface proteins

Cell Wall Integrity Assessment:

  • β-glucanase sensitivity assays to evaluate cell wall robustness

  • Calcofluor white and Congo red sensitivity tests to assess cell wall defects

  • Transmission electron microscopy to examine cell wall ultrastructure

Glycosylation Analysis:

  • Lectin binding assays to assess surface glycosylation patterns

  • Mass spectrometry of GPI-anchored proteins to analyze GPI structure

  • Metabolic labeling with radioactive mannose to track GPI biosynthesis

Heterologous Protein Production Assessment:

  • Expression of model proteins (e.g., human growth hormone) in modified strains

  • Analysis of protein yield, stability, and glycosylation status

  • Purification efficiency comparison between wild-type and modified strains

By combining these methodologies, researchers can comprehensively evaluate how modifications to gpi10 impact the production and characteristics of GPI-anchored proteins in S. pombe.

How does disruption of gpi10 affect cell wall integrity and N-glycosylation in S. pombe?

The relationship between GPI-anchored proteins and N-glycosylation in S. pombe reveals complex cellular interactions. Research indicates that disruption of gpi10 has significant consequences for both GPI anchor biosynthesis and broader cell physiology:

Cell Wall Effects:
Disruption of gpi10 compromises cell wall integrity as GPI-anchored proteins are critical structural components. Similar to other GPI biosynthesis mutants, gpi10-deficient cells would likely show increased sensitivity to cell wall stressors such as β-glucanase, as demonstrated with other GPI-anchored protein mutants . The structural support provided by GPI-anchored proteins to β-glucan is disrupted, leading to reduced cell wall integrity.

N-Glycosylation Interactions:
There exists a functional cross-talk between N-linked glycans and GPI-anchored proteins in fission yeast. When N-glycosylation is compromised (as in och1Δ mutants), overexpression of certain GPI-anchored proteins can compensate for growth defects . This indicates a compensatory relationship between these two major glycosylation pathways. Conversely, when GPI biosynthesis is disrupted, it may influence N-glycosylation processes through altered ER homeostasis and protein quality control mechanisms.

Signaling Pathway Cross-Talk:
The cAMP-PKA pathway interacts with GPI biosynthesis in S. pombe, influencing morphological development . This signaling system's alterations in gpi10 mutants would affect cellular processes beyond just GPI anchor formation, potentially impacting filamentous growth and cellular responses to various stressors.

These interconnected effects highlight the complex role of gpi10 in maintaining cellular homeostasis beyond its direct enzymatic function in GPI anchor assembly.

What experimental strategies can measure the effects of gpi10 mutations on heterologous protein production?

When evaluating how gpi10 mutations affect heterologous protein production in S. pombe, researchers should implement a structured experimental approach:

Strain Construction and Validation:

  • Generate gpi10 mutant strains using CRISPR-Cas9 or traditional homologous recombination

  • Confirm mutations by sequencing and expression analysis

  • Characterize growth rates and cell morphology under standard conditions

Heterologous Protein Expression System:

  • Transform wild-type and gpi10 mutant strains with expression vectors containing:

    • Strong, controllable promoters (e.g., S. pombe ADH promoter)

    • Model proteins with varying characteristics:

      • GPI-anchored proteins (to directly assess GPI pathway)

      • Non-GPI proteins (to assess indirect effects)

      • Proteins with varying glycosylation requirements

Quantitative Production Assessment:

  • Protein yield analysis:

    • Direct measurement via Western blotting

    • ELISA assays for secreted proteins

    • Fluorescence quantification for reporter proteins

  • Protein quality assessment:

    • Activity assays (e.g., enzyme activity, binding assays)

    • Glycosylation analysis via mass spectrometry

    • Structural integrity via circular dichroism or thermal stability assays

Proteolytic Stability Analysis:
Given that proteolytic degradation is a major challenge in S. pombe heterologous protein production , analyze:

  • Proteolytic fragmentation patterns by Western blot

  • Half-life determination via pulse-chase experiments

  • Response to protease inhibitors

This comprehensive analytical framework enables detailed characterization of how gpi10 mutations specifically impact heterologous protein production, providing insights into both direct effects on GPI-anchored proteins and indirect effects on general secretory pathway function.

How can S. pombe gpi10 be modified to optimize heterologous glycoprotein production for therapeutic applications?

Engineering S. pombe gpi10 offers strategic opportunities to enhance therapeutic glycoprotein production:

Strategic Modifications for Optimized Production:

  • Controlled Expression Systems:

    • Develop regulatable gpi10 expression cassettes using titratable promoters

    • Implement temperature-sensitive alleles to fine-tune GPI biosynthesis

    • Balance gpi10 activity to avoid both insufficient anchoring and ER stress

  • Functional Domain Engineering:

    • Modify catalytic domains to alter efficiency while maintaining specificity

    • Engineer substrate recognition regions to optimize processing of specific proteins

    • Create chimeric proteins incorporating domains from mammalian homologs

  • Co-expression Strategies:

    • Implement coordinated expression of gpi10 with complementary GPI-anchored proteins

    • The overexpression of specific GPI-anchored proteins like Pwp1p has been shown to compensate for growth defects in glycosylation-deficient strains (och1Δ)

    • This co-expression approach leverages the natural compensatory mechanisms between glycosylation pathways

Outcomes Assessment Table:

Modification ApproachExpected Impact on ProductionMonitoring MethodsPotential Challenges
Reduced gpi10 activityDecreased GPI anchoring, potentially increased secretionWestern blot, secretion assaysCell wall integrity issues, growth defects
Increased gpi10 expressionEnhanced GPI anchoring, potentially reduced secretionCell surface protein analysisER stress, reduced yield of secreted products
Chimeric gpi10 variantsModified glycan structures, potentially humanized patternsMass spectrometry glycan analysisProtein misfolding, reduced enzyme activity
Co-expression with Pwp1pImproved growth and productivity in glycosylation-modified strainsGrowth rate analysis, protein yield measurementMetabolic burden, complex regulation

Integration with N-glycosylation Engineering:
Combining gpi10 modifications with established N-glycosylation engineering (e.g., och1Δ strains that produce humanized N-glycans) could create optimized S. pombe platforms for therapeutic protein production . This integrated approach addresses both major glycosylation pathways simultaneously.

What analytical techniques best characterize the functional activity of recombinant gpi10 in vitro?

Assessing recombinant gpi10 functionality requires sophisticated analytical approaches:

Enzyme Activity Assays:

  • In vitro mannosyltransferase assay:

    • Substrate preparation: Synthetic GPI intermediates lacking Man-3

    • Donor preparation: GDP-mannose (radiolabeled or fluorescently tagged)

    • Reaction conditions: Optimize temperature, pH, metal cofactors

    • Detection methods: TLC, HPLC, or mass spectrometry

  • Reconstituted membrane systems:

    • Liposome incorporation of purified gpi10

    • Nanodisc assembly for membrane protein stabilization

    • Cell-free expression systems with microsomal membranes

Structural and Interaction Studies:

  • Binding assays:

    • Surface plasmon resonance to measure substrate binding kinetics

    • Thermal shift assays to assess ligand binding

    • Isothermal titration calorimetry for thermodynamic parameters

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with other GPI biosynthesis components

    • Crosslinking mass spectrometry to identify interaction interfaces

    • FRET-based assays for proximity detection in reconstituted systems

Biophysical Characterization:

  • Secondary structure assessment:

    • Circular dichroism spectroscopy

    • FTIR spectroscopy for membrane proteins

  • Stability and integrity:

    • Limited proteolysis to identify domain boundaries

    • Differential scanning calorimetry for thermal stability

    • Native mass spectrometry for quaternary structure

These methodologies provide complementary information on recombinant gpi10 activity, allowing researchers to fully characterize the enzyme's function in controlled in vitro conditions.

How does the function of gpi10 in S. pombe compare to its homologs in pathogenic fungi, and what are the implications for antifungal development?

Comparative analysis of gpi10 across fungal species reveals important evolutionary adaptations and potential therapeutic targets:

Functional Conservation and Divergence:

Structural Comparison Analysis:

Fungal Speciesgpi10 Sequence Identity to S. pombeKey Structural DifferencesPotential Targeting Strategy
S. cerevisiae~60-70%Differences in active site architectureActive site-specific inhibitors
C. albicans~50-60%Unique regulatory domainsAllosteric modulators
A. fumigatus~40-50%Modified transmembrane organizationMembrane interface inhibitors
C. neoformans~35-45%Altered substrate recognition residuesCompetitive substrate analogs

GPI Biosynthesis as an Antifungal Target:

GPI biosynthesis represents an attractive target for antifungal development because:

  • It is essential for fungal viability

  • The pathway contains fungal-specific features distinct from mammalian systems

  • Cell wall anchoring of GPI-proteins is critical for pathogenicity

Specific inhibitors targeting gpi10 could disrupt cell wall integrity in pathogenic fungi while potentially sparing human cells due to structural differences in the target enzyme. The research approach pioneered in S. pombe, including genetic manipulation and protein characterization techniques, provides valuable tools for studying gpi10 homologs in less genetically tractable pathogenic species.

What research approaches can elucidate the regulatory network controlling gpi10 expression and activity in S. pombe?

Understanding the regulatory landscape governing gpi10 requires integrated research strategies:

Transcriptional Regulation Analysis:

  • Promoter characterization:

    • Reporter gene fusions (similar to those used with the ADH promoter)

    • Chromatin immunoprecipitation to identify transcription factor binding

    • CRISPR interference for targeted repression studies

  • Transcriptome profiling:

    • RNA-seq analysis under various stress conditions

    • GRO-seq for nascent transcription analysis

    • Single-cell RNA-seq for population heterogeneity assessment

Post-translational Regulation:

  • Modification mapping:

    • Phosphoproteomic analysis to identify regulatory phosphorylation sites

    • Ubiquitylation profiling to assess protein stability control

    • Glycosylation analysis for self-regulation via N-glycans

  • Protein interaction networks:

    • BioID or proximity labeling to identify interacting partners

    • Tandem affinity purification for complex composition

    • Yeast two-hybrid screening for direct interactions

Signaling Pathway Integration:

  • Cross-talk with stress response pathways:

    • Analysis of cAMP-PKA pathway connections

    • Cell wall integrity signaling influence

    • ER stress response pathway interactions

  • Metabolic regulation:

    • Lipidomic profiling to correlate lipid composition with gpi10 activity

    • Carbon source effects on expression and activity

    • Growth phase-dependent regulation

These complementary approaches would construct a comprehensive regulatory network model explaining how gpi10 expression and activity are fine-tuned in response to cellular needs and environmental conditions, providing deeper insights into GPI biosynthesis control in eukaryotes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.