Recombinant Schizosaccharomyces pombe GPI transamidase component gaa1 (gaa1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
gaa1; SPAC1002.11; GPI transamidase component gaa1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
gaa1
Target Protein Sequence
MSLFTFVQIRVFPFLQRHLFFLQLSLTLIGLSWIFILPRNEIIDRLHVSESALLPGQVNT YFENRYSKTVSSSLTAANTWSHLDASVGTNTMYDDLEQIFTAMGLPTQKQNYSINIPGSE FNGSNFITTLRAPRGDATESLLLCVPWKDHIGQYNEAGVALAISLLKYFQGWSLWSKDII LVIFDDPVYGPSSFLTSYFDQTTPYISYTPLKIRSGSIQAGLSLELVTTENNSDVLEVLY QATNGQLPNLDLFNTISRIFMQHFNYPLRLQGYDFHANSGSSYTSRLKSLWMGMLTQAVS NVTSAHALFPQYRIDMLTLRMKVKDPFSFDMFRFGQAIESTFRSLNNLLEHLHQSFFFYF ILDHLHFISIGNYMPSILILAASFMLGAYRHWINHEKKIDLWRPFSFWLFSIFCTIAAYY LVSSSTKITVFIFLYLMLTFIGIIFSTFMTSEDAELVLSYDLMSKSLFISVVSTLNFSLS FVVAILLVPLQFISFRFNRRLSLLFAVLTYFSTFIFLCSLSKILNGPLVPFWLWAKEYEL FNSWLMPSVFMILVLPEIIFSVTSFFSLWNEPSVKTKTKTL
Uniprot No.

Target Background

Function
Component of the GPI transamidase complex. It plays a crucial role in the final step of GPI anchor attachment to proteins.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Gaa1 in Schizosaccharomyces pombe and what is its biological significance?

Gaa1 (GPI-anchor transamidase complex subunit Gaa1) is an essential component of the GPI transamidase complex in Schizosaccharomyces pombe. This protein plays a critical role in the post-translational attachment of glycosylphosphatidylinositol (GPI) anchors to proteins destined for cell surface expression. The gene is identified by Entrez Gene ID 2543268 and classified as protein-coding .

The biological significance of Gaa1 stems from its pivotal role in the GPI anchoring pathway, which is essential for proper cell surface protein expression, cell wall integrity, and membrane organization in eukaryotes. In S. pombe, this process is crucial for normal cellular growth, division, and sexual differentiation processes .

Gaa1 represents a highly conserved protein across species, with homologs identified in various organisms including:

OrganismGene SymbolProtein Accession
Homo sapiens (human)GPAA1NP_003792.1
Mus musculus (mouse)Gpaa1NP_034461.1
Rattus norvegicus (rat)Gpaa1NP_001004240.1
Saccharomyces cerevisiae (baker's yeast)GAA1NP_013189.1
Schizosaccharomyces pombe (fission yeast)gaa1NP_593498.1
Drosophila melanogaster (fruit fly)CG3033NP_572273.2
Xenopus tropicalis (frog)gpaa1NP_001015809.1
Danio rerio (zebrafish)LOC555496XP_005171175.1

What are the optimal conditions for expressing recombinant S. pombe Gaa1 protein?

The expression of recombinant S. pombe Gaa1 requires careful optimization due to its complex membrane-associated nature. Based on established protocols, the following expression conditions have proven effective:

Expression System Selection:

  • E. coli expression systems are commonly used for partial or modified constructs

  • Mammalian cell expression systems are preferred for full-length functional protein, especially when studying interactions with other GPI transamidase components

  • Yeast expression systems (particularly S. cerevisiae) may provide advantages for proper folding and post-translational modifications

Optimization Parameters for E. coli Expression:

  • Use of BL21(DE3) or Rosetta(DE3) strains to account for rare codons

  • Induction at lower temperatures (16-20°C) to enhance proper folding

  • Lower IPTG concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies

  • Addition of membrane-stabilizing agents such as glycerol (5-10%) to the growth media

For membrane proteins like Gaa1, expression as fusion proteins with solubility-enhancing tags (His, MBP, GST) significantly improves yield and solubility. The N-terminally His-tagged construct has shown reliable expression and purification characteristics .

What are the most effective methods for purifying recombinant Gaa1 protein?

Purification of recombinant Gaa1 requires specialized approaches due to its hydrophobic nature and multiple transmembrane domains. The following methodology has proven effective based on published protocols:

Extraction and Solubilization:

  • Cell lysis under native conditions using mild detergents (Nonidet P-40, n-Dodecyl β-D-maltoside, or CHAPS)

  • Careful optimization of detergent-to-protein ratios to maintain native structure

  • Inclusion of protease inhibitors throughout all purification steps

Purification Strategy for His-tagged Recombinant Gaa1:

  • Initial capture using immobilized metal affinity chromatography (IMAC)

  • Optional intermediate purification step using ion exchange chromatography

  • Final polishing via size exclusion chromatography

Buffer Optimization:
The choice of buffer significantly impacts stability and yield. Recommended buffers include:

  • Extraction: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% detergent, 10% glycerol

  • Purification: 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 10% glycerol

  • Storage: Tris/PBS-based buffer with 6% trehalose or 50% glycerol at pH 8.0

For highest purity (>90% as determined by SDS-PAGE), a combination of techniques is recommended, with careful attention to detergent concentration throughout the purification process .

How do truncation mutations affect Gaa1 function in the GPI transamidase complex?

Truncation studies have provided valuable insights into the structural domains of Gaa1 required for its function and interaction with other GPI transamidase complex components. Research using C-terminal deletion variants has revealed:

  • Interaction with Complex Components:

    • The N-terminal region and first two transmembrane domains (TM) of Gaa1 are sufficient for interaction with other GPIT subunits (Gpi8, PIG-S, and PIG-T)

    • Constructs lacking up to five C-terminal TM domains (D2-D6) maintained their ability to interact with Gpi8, PIG-S, and PIG-T

    • The smallest construct (D7), containing only the first N-terminal TM domain and lumenal loop, failed to interact with other GPIT components

  • Functional Activity:

    • Despite maintaining protein interactions, truncated Gaa1 variants lacking C-terminal transmembrane segments rendered the resulting GPI transamidase complex non-functional

    • This indicates that while not essential for complex formation, the C-terminal region is critical for the catalytic activity of the complex

  • Sedimentation Behavior:

    • Full-length Gaa1-containing GPIT complexes sediment at approximately 17S

    • Truncated variants show altered sedimentation patterns, suggesting structural changes in the complex architecture

These findings demonstrate that Gaa1 has distinct structural domains with separate roles in complex assembly versus catalytic function.

What are the critical amino acid residues in Gaa1 that determine its function?

While the complete functional mapping of all critical residues in S. pombe Gaa1 is still under investigation, several key structural features and amino acid regions have been identified as essential for proper function:

  • Transmembrane Domain Organization:

    • The N-terminal transmembrane domain is essential for proper localization and initial protein interactions

    • The C-terminal transmembrane segments (particularly TM2-TM7) are critical for the catalytic function of the GPI transamidase complex

  • Lumenal Domains:

    • The larger lumenal domain between TM1 and TM2 participates in protein-protein interactions with other GPIT subunits

    • This region contains several conserved residues that may participate in substrate recognition

  • Conserved Motifs:
    Analysis of the amino acid sequence reveals several highly conserved regions across species that likely represent functionally important motifs:

    • A conserved motif in the first lumenal domain (residues 59-72) may be involved in protein-protein interactions

    • Several conserved regions in the multiple transmembrane segments (particularly in TM2 and TM3) likely contribute to proper membrane integration and complex stability

Site-directed mutagenesis studies of these conserved regions would further elucidate the specific roles of individual amino acids in Gaa1 function.

How can recombinant Gaa1 be used to study the GPI transamidase complex assembly?

Recombinant Gaa1 provides a powerful tool for investigating GPI transamidase complex assembly through several methodological approaches:

  • Co-immunoprecipitation Assays:

    • Epitope-tagged Gaa1 (FLAG, His, or V5) can be used to pull down native complex components

    • This approach has successfully demonstrated interaction patterns between different GPIT subunits

    • The method involves:
      a) Expression of tagged Gaa1 in appropriate cells
      b) Extraction with non-denaturing detergent (e.g., Nonidet P-40)
      c) Incubation with anti-tag antibodies (e.g., anti-FLAG-agarose beads)
      d) Analysis of co-precipitated proteins by immunoblotting

  • Velocity Sedimentation Analysis:

    • This technique allows assessment of complex formation and stability

    • By analyzing the sedimentation behavior of wild-type versus mutant Gaa1 constructs, researchers can determine effects on complex assembly

    • The procedure typically involves:
      a) Extraction of Gaa1-containing complexes
      b) Centrifugation through a gradient (e.g., 5-20% sucrose)
      c) Collection of fractions and analysis by immunoblotting

  • Bioluminescence Resonance Energy Transfer (BRET) or Förster Resonance Energy Transfer (FRET):

    • These techniques enable real-time monitoring of protein-protein interactions

    • By fusing Gaa1 and other GPIT components with appropriate fluorescent/luminescent tags, researchers can study complex assembly dynamics in living cells

  • Split-Ubiquitin Yeast Two-Hybrid System:

    • This modified yeast two-hybrid approach is particularly suitable for membrane proteins like Gaa1

    • It allows mapping of specific interaction domains between Gaa1 and other GPIT components

These methods can be combined to provide comprehensive insights into complex assembly, dynamics, and the effects of mutations or environmental changes on complex stability.

What methods are recommended for studying Gaa1 membrane topology?

Understanding the membrane topology of Gaa1 is crucial for elucidating its function within the GPI transamidase complex. Several complementary approaches are recommended:

  • Protease Protection Assays:

    • This method determines which protein domains are exposed on each side of the membrane

    • Protocol overview:
      a) Isolation of microsomes or membrane fractions containing Gaa1
      b) Treatment with proteases (e.g., trypsin, proteinase K) in the presence or absence of membrane-permeabilizing detergents
      c) Analysis of protected fragments by immunoblotting using domain-specific antibodies

  • Glycosylation Site Mapping:

    • Natural or engineered N-glycosylation sites can serve as topology markers since glycosylation occurs only in the ER lumen

    • By analyzing which potential glycosylation sites are modified, researchers can map the lumenal domains of Gaa1

    • This approach has confirmed that the C-terminus of Gaa1 is lumenally oriented

  • Cysteine Scanning Mutagenesis:

    • Sequential replacement of amino acids with cysteine residues

    • Treatment with membrane-impermeable sulfhydryl reagents to identify exposed cysteines

    • This approach provides detailed information about which specific residues are accessible from each side of the membrane

  • Fluorescence Microscopy with Domain-Specific Tags:

    • Introduction of fluorescent protein tags at different positions

    • Analysis of tag accessibility to antibodies before and after membrane permeabilization

    • This approach has helped establish that the N-terminus of Gaa1 is cytoplasmically oriented

A comprehensive topological model of Gaa1 should integrate data from multiple approaches to overcome limitations of individual methods.

How does Gaa1 contribute to sexual differentiation in S. pombe?

While direct evidence linking Gaa1 specifically to sexual differentiation in S. pombe is limited in the provided search results, its role can be inferred from our understanding of GPI-anchored proteins and cellular processes in fission yeast:

S. pombe undergoes sexual differentiation under nitrogen starvation conditions when cells of opposite mating types are present, leading to conjugation, meiosis, and spore formation . This process involves extensive cell surface remodeling and signaling pathways where GPI-anchored proteins play essential roles:

  • Cell Surface Adhesion and Recognition:

    • GPI-anchored adhesins and agglutinins mediate initial cell-cell contact during mating

    • As the enzyme responsible for GPI anchor attachment, Gaa1 dysfunction would likely impair expression of these critical cell surface proteins

  • Signaling Pathway Integration:

    • Sexual differentiation in S. pombe is regulated by several interconnected pathways:

      • Glucose-sensing cAMP-PKA pathway

      • Nitrogen-sensing TOR pathway

      • Stress-activating protein kinase (SAPK) pathway

      • MAPK cascade for pheromone sensing

    • Many components of these pathways are localized to the membrane through GPI anchors, requiring functional Gaa1

  • Cell Cycle Regulation:

    • Sexual differentiation requires G1 arrest, mediated by regulation of cyclins like Cig2 and CDK inhibitors like Rum1

    • Cell surface receptors that influence cell cycle progression often require GPI anchoring for proper function

While direct studies examining Gaa1 mutants and their effects on sexual differentiation are not detailed in the search results, the essential nature of the GPI anchoring process suggests that Gaa1 dysfunction would significantly impair multiple aspects of the mating process in S. pombe.

How can researchers use S. pombe Gaa1 as a model to study human GPAA1-related disorders?

S. pombe Gaa1 shares significant homology with human GPAA1 (GPI anchor attachment protein 1), making it a valuable model for studying mechanisms relevant to human disease . Several methodological approaches can leverage this evolutionary conservation:

  • Complementation Studies:

    • Expression of human GPAA1 in S. pombe gaa1 mutants to assess functional conservation

    • Creation of "humanized" yeast strains where critical domains of S. pombe Gaa1 are replaced with corresponding human GPAA1 regions

    • This approach can identify functionally important regions and evaluate the impact of disease-associated mutations

  • Modeling Disease Mutations:

    • Introduction of mutations corresponding to human disease variants into S. pombe Gaa1

    • Analysis of resulting phenotypes related to:
      a) GPI transamidase complex assembly
      b) Catalytic activity
      c) Cellular stress responses
      d) Growth characteristics
      e) Cell morphology

  • High-Throughput Screening Platforms:

    • Development of S. pombe-based assays to screen for compounds that rescue defects in Gaa1 function

    • Utilization of growth, fluorescence, or reporter gene readouts to assess GPI anchoring efficiency

    • This approach could identify potential therapeutic compounds for GPAA1-related disorders

  • Proteomic Analysis:

    • Comparative proteomics to identify changes in GPI-anchored protein populations when Gaa1 function is compromised

    • This can reveal cellular pathways most sensitive to GPI anchoring defects

The advantages of using S. pombe include its genetic tractability, rapid growth, and the ability to study essential genes like Gaa1 through conditional expression systems or partial loss-of-function alleles.

What are common challenges in working with recombinant Gaa1 and how can they be addressed?

Working with recombinant Gaa1 presents several technical challenges due to its multiple transmembrane domains and complex structure. Here are the most common issues and recommended solutions:

  • Low Expression Yields:

    • Challenge: Membrane proteins like Gaa1 often express poorly in heterologous systems

    • Solutions:
      a) Optimize codon usage for the expression system
      b) Use lower induction temperatures (16-20°C)
      c) Consider fusion partners that enhance solubility (MBP, SUMO, Trx)
      d) Test expression in multiple host systems (E. coli, yeast, insect cells)

  • Protein Aggregation/Inclusion Body Formation:

    • Challenge: Improper folding leading to aggregation

    • Solutions:
      a) Include detergents or lipids during expression and purification
      b) Add stabilizing agents like glycerol (5-10%) or trehalose (6%)
      c) Use slow, controlled induction protocols
      d) Consider refolding protocols from inclusion bodies if necessary

  • Degradation During Purification:

    • Challenge: Proteolytic sensitivity of Gaa1

    • Solutions:
      a) Use comprehensive protease inhibitor cocktails
      b) Maintain cold temperatures throughout purification
      c) Minimize purification time
      d) Consider adding stabilizing agents to all buffers

  • Loss of Native Conformation:

    • Challenge: Detergent-mediated disruption of structure

    • Solutions:
      a) Screen multiple detergents (DDM, CHAPS, Nonidet P-40)
      b) Use detergent concentrations just above CMC
      c) Consider native nanodiscs or amphipols for detergent-free systems
      d) Validate protein folding using circular dichroism or functional assays

Storage recommendations for purified recombinant Gaa1 include:

  • Storage buffer: Tris/PBS-based buffer with 6% trehalose or 50% glycerol, pH 8.0

  • Storage temperature: -20°C/-80°C for long-term storage

  • Avoiding repeated freeze-thaw cycles by preparing working aliquots

  • For short-term use, store working aliquots at 4°C for up to one week

How can researchers verify the functional activity of recombinant Gaa1 proteins?

Verifying that recombinant Gaa1 retains its functional activity is crucial for experimental validity. Several complementary approaches are recommended:

  • Complex Assembly Assays:

    • Method: Co-immunoprecipitation with other GPIT components (Gpi8, PIG-S, PIG-T)

    • Expected Result: Functional Gaa1 should efficiently co-precipitate with other complex components

    • Controls: Compare with known non-functional mutants (e.g., D7 construct)

  • Subcellular Localization:

    • Method: Immunofluorescence or fractionation studies

    • Expected Result: Proper ER localization, consistent with endogenous Gaa1

    • Controls: Include markers for ER and other organelles

  • Complementation Assays:

    • Method: Expression of recombinant Gaa1 in Gaa1-deficient cells

    • Expected Result: Restoration of GPI anchoring activity and normal cellular phenotypes

    • Controls: Empty vector and known non-functional mutants

  • In Vitro Transamidase Activity:

    • Method: Reconstitution of GPI transamidase activity using purified components

    • Substrate: Fluorescently labeled peptides containing the GPI attachment signal

    • Detection: HPLC or gel-based analysis of GPI anchor attachment

    • Controls: Reactions without Gaa1 or with known inactive mutants

  • Structural Integrity Assessment:

    • Method: Limited proteolysis patterns compared to native protein

    • Expected Result: Similar digestion patterns indicating proper folding

    • Controls: Denatured protein as negative control

These validation methods should be selected based on the specific research questions and available resources. For most applications, complementation assays provide the most physiologically relevant indication of functional activity.

What are promising areas for future research on S. pombe Gaa1 and GPI transamidase function?

Several exciting directions for future research on S. pombe Gaa1 warrant exploration:

  • High-Resolution Structural Studies:

    • Application of cryo-electron microscopy to elucidate the complete structure of the GPI transamidase complex

    • Structural comparisons between S. pombe and human complexes to identify conserved and divergent features

    • Structure-guided design of specific inhibitors or modulators of GPI transamidase activity

  • Dynamic Regulation of GPI Anchoring:

    • Investigation of how environmental conditions and cellular stresses modulate Gaa1 expression and function

    • Identification of post-translational modifications that regulate Gaa1 activity

    • Exploration of how GPI anchoring is coordinated with other cellular processes during the S. pombe life cycle

  • Systems Biology Approaches:

    • Comprehensive identification of all GPI-anchored proteins in S. pombe under different conditions

    • Network analysis to understand how GPI anchoring influences broader cellular signaling networks

    • Mathematical modeling of GPI anchor synthesis and attachment to predict system behaviors

  • Evolutionary Perspectives:

    • Comparative analysis of Gaa1 function across evolutionary distant species

    • Identification of selective pressures that have shaped Gaa1 evolution

    • Understanding how GPI anchoring mechanisms have adapted to different cellular environments

  • Technological Innovations:

    • Development of improved tools for real-time monitoring of GPI anchoring in living cells

    • Creation of synthetic biology approaches to rewire GPI anchoring pathways

    • Application of genome editing technologies to create precise mutations for structure-function studies

These research directions would significantly advance our understanding of fundamental cellular processes while potentially revealing new therapeutic targets for diseases involving GPI anchoring defects.

How might advances in studying S. pombe Gaa1 contribute to understanding human diseases?

Research on S. pombe Gaa1 has significant translational potential for understanding and addressing human diseases:

  • Inherited GPI Biosynthesis Disorders:

    • Multiple congenital disorders result from mutations in GPI biosynthesis genes, including GPAA1 (human homolog of Gaa1)

    • Studies in S. pombe can provide mechanistic insights into how specific mutations affect protein function

    • The simplicity of the fission yeast system enables clear delineation of pathogenic mechanisms

  • Cancer Biology:

    • Altered GPI anchoring has been implicated in cancer progression and metastasis

    • S. pombe models can help elucidate how changes in GPI anchoring affect:
      a) Cell-cell adhesion properties
      b) Signal transduction pathways
      c) Response to therapeutic agents

  • Neurodegenerative Diseases:

    • Several GPI-anchored proteins play roles in neurodegenerative processes

    • Understanding fundamental GPI anchoring mechanisms may reveal new therapeutic approaches

    • S. pombe provides a tractable system to study conserved aspects of protein trafficking and processing

  • Infectious Disease Applications:

    • Many pathogens (particularly protozoan parasites) rely on GPI-anchored proteins for virulence

    • Differences between host and pathogen GPI anchoring machinery could be exploited for therapeutic development

    • S. pombe studies may identify conserved features that could serve as targets for anti-infective agents

  • Biotechnology Applications:

    • Improved understanding of Gaa1 function could enable development of:
      a) Better expression systems for GPI-anchored proteins
      b) Novel approaches for cell surface engineering
      c) Improved biopharmaceutical production methods

The fundamental conservation of GPI anchoring mechanisms across eukaryotes makes insights gained from S. pombe Gaa1 research highly relevant to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.