Recombinant Schizosaccharomyces pombe GPI transamidase component PIG-S homolog (SPAC1F12.09)

Shipped with Ice Packs
In Stock

Description

Biological Role in GPI Anchor Biosynthesis

PIG-S is an essential subunit of the GPI transamidase complex, which catalyzes the transfer of preassembled GPI anchors to nascent proteins in the endoplasmic reticulum. Key findings include:

  • Complex Composition: GPI transamidase comprises four subunits: GAA1, GPI8, PIG-S, and PIG-T. All are required for enzymatic activity .

  • Functional Mechanism:

    • Mediates cleavage of the C-terminal signal peptide from target proteins.

    • Forms a carbonyl intermediate during transamidation, a step disrupted in PIG-S-deficient cells .

  • Evolutionary Conservation: Orthologues exist in Saccharomyces cerevisiae (Gpi17p) and humans, underscoring functional conservation .

4.1. Functional Studies

  • Knockout Models: Disruption of PIG-S in mouse F9 cells abolished GPI anchoring, leading to accumulation of immature GPI precursors .

  • Yeast Studies: S. pombe PIG-S homolog (Gpi17p) is required for viability, confirming its essential role .

Challenges and Future Directions

  • Structural Resolution: The full 3D structure of the GPI transamidase complex remains unresolved.

  • Therapeutic Potential: GPI anchoring defects are linked to human diseases (e.g., paroxysmal nocturnal hemoglobinuria), making this protein a target for mechanistic studies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
gpi17; SPAC1F12.09; GPI transamidase component PIG-S homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
gpi17
Target Protein Sequence
MSPCKWLTMFLKGCWGKIANMNHLDSCFPLRYIIGRKKASKLLCTMDSGLKSDSHEVERS NFQLNKPEKSLKRYALLSFYVIILLAIPVWWKTTHYERSSLPFEDMENAPSTVQTHLRFS PTFRILDDKGNNLTKEVQKVLEAEPQIYSYNLKVLEDDPVDYRIVLRESTDLQWFWDENN FIIDTPSKGPSELAILIVNCLWEAFSPQVMEVWSKFTRFSSTVEPSRAETKRTVQFSPQY RVLLSLLVGEGNHEPINWDIENAIQKYFNPLIEQLASLAKLNIETQIQYFVEDAEAYIKD DKFCTKHADLPNLVNNFEKYLSFSPHIREPTIHFVLYVPSPQIQPLWLENEDSNIIPTNS MLLPQWGSITTINFNVTEKKLLHDVDLKDYFRVISRDLLLLLGINDVPVSSLSATLADRL LRQRIAESCIEASDTLQNLAKLVHSMQSMAVPKEIQMYVKDTLLSLDMAYKALSQNNLNE ALSYSNNAFSKSQEALFHPSMVTTIYFPDESKYGIYAPLFAPILIPLLISFIKEVKDMLR ERKLHRVANVPKPN
Uniprot No.

Target Background

Function
A component of the GPI transamidase complex, involved in the transfer of glycosylphosphatidylinositol (GPI) anchors to proteins.
Database Links
Protein Families
PIGS family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the GPI transamidase PIG-S homolog in Schizosaccharomyces pombe and what is its role?

The PIG-S homolog in Schizosaccharomyces pombe is an essential component of the GPI transamidase complex, which is responsible for attaching glycosylphosphatidylinositol (GPI) anchors to proteins. This process is crucial for the localization of many proteins to the cell surface. The PIG-S protein works in conjunction with other components of the GPI transamidase complex, including GAA1, GPI8, and PIG-T, to catalyze the transfer of GPI to proteins and is particularly important in the formation of carbonyl intermediates during this reaction . The S. pombe PIG-S homolog shares significant structural similarities with its counterparts in other species, including humans, Saccharomyces cerevisiae, Drosophila melanogaster, and Caenorhabditis elegans, suggesting evolutionary conservation of this critical cellular machinery .

How is the GPI transamidase complex organized in Schizosaccharomyces pombe?

In Schizosaccharomyces pombe, the GPI transamidase functions as a multi-protein complex comprising at least four essential components: PIG-S, PIG-T, GAA1, and GPI8. All four components are required for the proper functioning of the GPI transamidase . These proteins form a tightly associated complex, with PIG-T playing a particularly important role in maintaining complex stability by stabilizing the expression of GAA1 and GPI8 . The complex is localized to the endoplasmic reticulum membrane, where it processes newly synthesized proteins destined for GPI anchor attachment. The S. pombe GPI transamidase complex shares structural and functional homology with similar complexes in other eukaryotes, reflecting the evolutionary conservation of this essential cellular machinery across species .

What phenotypes are associated with PIG-S deficiency in Schizosaccharomyces pombe?

Deficiency in PIG-S function in Schizosaccharomyces pombe leads to severe defects in GPI anchor attachment to proteins. Specifically, cells lacking functional PIG-S are unable to generate either the carbonyl intermediate or GPI-anchored forms of proteins that normally receive this modification . This defect is similar to that observed in cells lacking other essential GPI transamidase components such as GAA1 and GPI8 . The inability to attach GPI anchors to proteins likely results in mislocalization of numerous cell surface proteins, which would have profound effects on cellular processes including cell wall integrity, nutrient uptake, and cell-cell communication. In other organisms such as Saccharomyces cerevisiae, disruption of GPI synthesis is lethal, suggesting that PIG-S deficiency in S. pombe would likely have similarly severe consequences for cell viability .

What are the optimal conditions for expressing recombinant PIG-S homolog in Schizosaccharomyces pombe?

For optimal expression of recombinant PIG-S homolog in Schizosaccharomyces pombe, researchers should consider using an inducible promoter system such as the nmt1 promoter, which allows for controlled expression levels. The expression vector should include the complete PIG-S coding sequence with appropriate S. pombe codon optimization to enhance translation efficiency. For membrane proteins like PIG-S, expression levels should be carefully monitored as overexpression can overwhelm the endoplasmic reticulum and trigger an unfolded protein response. Culture conditions should be optimized with growth at 30°C in standard EMM (Edinburgh minimal medium) with appropriate supplements based on auxotrophic requirements of the strain. For purification, adding an affinity tag such as His6 or FLAG to either the N-terminus or C-terminus can facilitate downstream isolation, though care must be taken to ensure the tag does not interfere with protein folding or function . The expression system should be validated by Western blot analysis and functional complementation assays in PIG-S deficient strains to confirm proper expression and activity.

How can researchers effectively purify the recombinant PIG-S protein while maintaining its functional integrity?

Purification of recombinant PIG-S from Schizosaccharomyces pombe requires careful consideration of its membrane-associated nature. Researchers should begin with gentle cell lysis using either enzymatic methods (such as zymolyase treatment) or mechanical disruption under cold conditions to prevent protein degradation . Membrane fractions containing PIG-S can be isolated through differential centrifugation, followed by solubilization using appropriate detergents such as digitonin, CHAPS, or DDM that maintain protein-protein interactions within the GPI transamidase complex. For affinity purification, conditions should be optimized to retain interaction with other complex components (GAA1, GPI8, and PIG-T) if a functional complex is desired . The purification buffer should contain stabilizing agents such as glycerol (10-20%) and protease inhibitors to prevent degradation. Size exclusion chromatography can be used as a final purification step to isolate intact protein complexes. Throughout the purification process, samples should be analyzed by activity assays, such as in vitro GPI transamidase assays, to confirm that functional integrity is maintained .

What mass spectrometry approaches are most effective for studying post-translational modifications of PIG-S in Schizosaccharomyces pombe?

For comprehensive analysis of post-translational modifications (PTMs) of PIG-S in Schizosaccharomyces pombe, researchers should employ a multi-faceted mass spectrometry approach. Initial sample preparation should include enrichment for phosphorylated species using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) when studying phosphorylation patterns . For analysis, a combination of bottom-up and top-down proteomics approaches is recommended. Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) using higher-energy collisional dissociation (HCD) and electron transfer dissociation (ETD) fragmentation methods provides complementary information about modification sites . Multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) can be used for targeted quantification of specific modified peptides. Data analysis should include search algorithms capable of identifying both anticipated modifications (phosphorylation, glycosylation) and unanticipated modifications. This approach has been successfully used in S. pombe to identify multiple phosphorylation sites in TOR complex components, suggesting similar success could be achieved with PIG-S .

How do mutations in the PIG-S gene affect the assembly and function of the GPI transamidase complex?

Mutations in the PIG-S gene can significantly impact both the assembly and function of the GPI transamidase complex in Schizosaccharomyces pombe. Different types of mutations may have varying effects depending on their location within the protein structure. Mutations in regions involved in protein-protein interactions might disrupt complex formation without affecting the intrinsic activity of PIG-S itself, whereas mutations in catalytic domains would directly impair enzymatic function . Studies in other systems have shown that loss of PIG-S prevents formation of the carbonyl intermediate during GPI anchoring, suggesting a direct role in the catalytic process . The impact of mutations can be assessed through complementation assays in PIG-S deficient strains, co-immunoprecipitation studies to evaluate complex formation, and in vitro GPI transamidase activity assays. Comparative analysis with similar mutations in homologous proteins from other species, such as the Saccharomyces cerevisiae GPI17, can provide additional insights into structure-function relationships within this evolutionarily conserved protein family .

How does the phosphorylation status of PIG-S affect its function in the GPI transamidase complex?

The phosphorylation status of PIG-S likely plays a significant regulatory role in its function within the GPI transamidase complex in Schizosaccharomyces pombe. While specific phosphorylation sites on PIG-S have not been explicitly characterized in the provided research, studies on other membrane protein complexes in S. pombe, such as TOR complexes, have shown that subunits are often multiply phosphorylated, suggesting a similar pattern may exist for GPI transamidase components . Phosphorylation could regulate multiple aspects of PIG-S function, including subcellular localization, protein-protein interactions within the complex, substrate recognition, or catalytic activity. For instance, phosphorylation of certain residues might induce conformational changes that either facilitate or inhibit interactions with other complex components or substrates. The kinases responsible for PIG-S phosphorylation in S. pombe remain to be identified, but candidates might include members of the TOR signaling pathway or other nutrient-responsive kinases . Recent studies in S. pombe have demonstrated that kinases like Dsk1 (a homolog of serine-arginine protein kinases) can regulate DNA repair proteins through direct phosphorylation , suggesting that similar kinase-substrate relationships might exist for regulating GPI transamidase components.

What can we learn about PIG-S function from studies on DNA damage response proteins in S. pombe?

Studies on DNA damage response proteins in Schizosaccharomyces pombe provide valuable insights into potential regulatory mechanisms that might apply to PIG-S function. Recent research on Dsk1, a homolog of serine-arginine protein kinases (SRPKs) in S. pombe, has demonstrated that phosphorylation plays a crucial role in regulating protein function during cellular stress responses . Dsk1 translocates to the nucleus upon replication stress and directly interacts with and phosphorylates Rad52, a key component of the homologous recombination repair machinery . This regulatory mechanism, involving stress-induced relocalization and targeted phosphorylation, might represent a broader paradigm applicable to other cellular processes, including GPI transamidase function. PIG-S, as a component of a multi-protein complex involved in an essential cellular process, might similarly be regulated through phosphorylation in response to specific cellular conditions. The methodologies employed in studying Dsk1-mediated phosphorylation, including phosphorylation site mapping, generation of phospho-defective and phospho-mimetic mutants, and functional complementation assays, could be effectively applied to investigate potential phosphoregulation of PIG-S .

What are the main technical challenges in studying membrane-bound proteins like PIG-S in S. pombe, and how can they be overcome?

Studying membrane-bound proteins like PIG-S in Schizosaccharomyces pombe presents several technical challenges. First, the isolation and purification of intact membrane protein complexes while maintaining their native conformations and interactions is difficult. This challenge can be addressed by using mild detergents (such as digitonin or CHAPS) for solubilization and implementing purification strategies that preserve protein-protein interactions, such as tandem affinity purification (TAP) adapted for membrane proteins . Second, obtaining sufficient protein yields for structural studies is challenging due to typically low expression levels of membrane proteins. This can be mitigated by optimizing expression systems with appropriate promoters and growth conditions, or by using newer technologies like cell-free expression systems adapted for membrane proteins. Third, determining the in vivo localization and dynamics of membrane proteins requires specialized approaches. Researchers can overcome this by employing super-resolution microscopy techniques or split-GFP complementation assays to visualize PIG-S in its native cellular context without disrupting its function . Finally, functional assays for GPI transamidase activity are complex and often indirect. This can be addressed by developing more direct activity assays, such as using fluorescently labeled peptide substrates or implementing mass spectrometry-based assays to directly monitor GPI anchor attachment to proteins.

How can researchers reconcile contradictory data when studying PIG-S function across different experimental systems?

When researchers encounter contradictory data studying PIG-S function across different experimental systems, a systematic approach to reconciliation is essential. First, conduct a thorough methodological comparison, examining differences in experimental conditions, strain backgrounds, protein constructs (particularly regarding tags and fusion proteins), and assay systems that might explain the discrepancies . Next, implement standardized protocols and controls across laboratories to minimize technical variability. When contradictions persist, consider biological explanations such as strain-specific genetic modifiers, epigenetic differences, or post-translational modifications that might affect PIG-S function in specific contexts . Employing multiple complementary approaches to address the same question can provide converging evidence - for instance, combining genetic knockouts with chemical inhibition, or integrating in vivo studies with in vitro biochemical assays. Quantitative approaches are particularly valuable; rather than binary (yes/no) outcomes, measure parameters across conditions to identify condition-dependent effects. Finally, consider the possibility that contradictory results reflect genuine biological complexity rather than experimental artifacts - PIG-S may indeed function differently under varying cellular contexts or in different genetic backgrounds .

What emerging technologies could advance our understanding of PIG-S function in S. pombe?

Several emerging technologies hold promise for advancing our understanding of PIG-S function in Schizosaccharomyces pombe. CRISPR-Cas9 genome editing systems, recently adapted for S. pombe, allow for precise genetic manipulation to create conditional alleles, tagged versions, or domain-specific mutations of PIG-S to dissect its function with unprecedented precision . Advanced imaging techniques such as super-resolution microscopy (PALM/STORM or STED) would enable visualization of PIG-S localization and dynamics within the endoplasmic reticulum at nanometer resolution. Cryo-electron microscopy has revolutionized structural biology of membrane protein complexes and could be applied to determine the structure of the entire GPI transamidase complex with PIG-S in its native state . Proximity labeling approaches such as TurboID or APEX2 could map the protein interaction neighborhood of PIG-S under various cellular conditions. Proteomics approaches including global absolute quantification (AQUA) peptide strategies could determine stoichiometric relationships within the complex . Single-cell technologies might reveal cell-to-cell variability in PIG-S expression or function, potentially uncovering heterogeneity not apparent in population-level studies. Integration of these technologies with computational modeling could provide a systems-level understanding of how PIG-S functions within the broader cellular context.

How might understanding PIG-S function contribute to broader questions in cell biology?

Understanding PIG-S function in Schizosaccharomyces pombe has significant implications for broader questions in cell biology. As a component of the GPI transamidase complex, PIG-S is integral to the process of attaching GPI anchors to proteins - a post-translational modification crucial for protein sorting, membrane organization, and cell surface display . Deeper insights into PIG-S function could illuminate fundamental principles of protein trafficking and membrane organization across eukaryotes. The GPI anchoring pathway intersects with multiple cellular processes including quality control in the endoplasmic reticulum, lipid metabolism, and cell wall biogenesis, making PIG-S a node in a complex cellular network . From an evolutionary perspective, comparing PIG-S function across species from yeasts to humans could reveal both conserved mechanisms and adaptive specializations in membrane protein processing . Additionally, since defects in GPI anchoring in humans are associated with paroxysmal nocturnal hemoglobinuria and other diseases, insights from the tractable S. pombe model could have translational relevance. Finally, the regulatory mechanisms governing PIG-S activity, particularly under stress conditions, might exemplify broader principles of how cells adapt essential processes to changing environments - a fundamental question in cell biology with relevance to understanding cellular resilience and adaptation .

What is the comparative analysis of key structural and functional domains across PIG-S homologs in different species?

The comparative analysis of PIG-S homologs across different species reveals both conserved and divergent features that provide insights into the evolution and function of this essential protein. The table below summarizes key characteristics of PIG-S homologs in selected model organisms:

SpeciesProtein NameLength (aa)Identity with Human PIG-SKey DomainsUnique Features
Homo sapiensPIG-S534100%Transmembrane domain, Luminal catalytic domainReference sequence
Schizosaccharomyces pombePIG-S homolog~530~26-28%Similar hydrophobicity profile to human PIG-SAdapted to fission yeast membrane environment
Saccharomyces cerevisiaeGpi17p (YDR434W)~550~25-27%Similar domain organization to human PIG-SEssential for viability in S. cerevisiae
Drosophila melanogasterPIG-S homolog~540~30%Conserved catalytic residuesPotentially involved in developmental processes
Caenorhabditis elegansPIG-S homolog~545~29%Conserved membrane topologyModel for studying GPI anchoring in nematodes

The hydrophobicity profiles of PIG-S proteins are remarkably conserved across species, suggesting preservation of membrane topology despite sequence divergence . All homologs contain regions critical for interaction with other GPI transamidase components, particularly GAA1, GPI8, and PIG-T. Functional studies have confirmed that the S. cerevisiae homolog Gpi17p is essential for GPI transamidase activity, similar to human PIG-S, indicating conservation of core functionality across evolutionary distance . Species-specific adaptations likely reflect differences in membrane composition, substrate proteins requiring GPI anchors, and integration with other cellular pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.