Recombinant Schizosaccharomyces pombe GTPase-activating protein gyp10 (gyp10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
gyp10; SPBC651.03c; GTPase-activating protein gyp10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
gyp10
Target Protein Sequence
MKKKEIKQLKNEIKIALLNSDVETLSHIGKEGHGFLMKSLRKSVWVSLCGLSCRHRMECL SRSTSQSSYADQNQVHLDSERSFFQYKLNPFLLRKHRSQLTKLLSVVFKHYPELCYYQGL HDIAQILLLTLPFSHALPLMEHLVFYRLRDFMLPTLDGTVKQLQLILAVIKARDPTLYEY LIKADIQCYFALSWLITWFAHDVSDISVVCRLFDFFISSHPLTVVYTCAQVVLDNRTSII ELLWDNSGADLLHSYLCKLPASINVNQLIKNTCATISAVPFSSLPLDRYQISPYSCLRNT GDPWEYMSRSNGLLLFRLQLAELQEEKHKPGTKVPAVFLQENIFNGCNMLAAITVIGIGI VASQLIPKSTSNS
Uniprot No.

Target Background

Function
Plays a role in vesicular trafficking and septation during cytokinesis.
Gene References Into Functions
  1. Gyp10 encodes a Rab GTPase-activating protein (GAP), a negative regulator of Rab GTPase signaling. PMID: 24350606
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is gyp10 and what is its role in Schizosaccharomyces pombe?

Gyp10 is a GTPase-activating protein (GAP) encoded by the gyp10 gene in Schizosaccharomyces pombe (fission yeast). The protein is 373 amino acids in length and has a molecular function related to regulating GTPase activity . While the specific cellular functions of gyp10 are not comprehensively documented in the current literature, GTPase-activating proteins typically regulate the hydrolysis of GTP to GDP on small GTPases, serving as molecular switches in various cellular pathways. The amino acid sequence of gyp10 contains domains characteristic of GAP proteins that facilitate this regulatory function .

To study the function of gyp10, researchers typically use a combination of:

  • Genetic manipulation techniques (gene deletion, mutation)

  • Protein-protein interaction studies

  • Localization studies using fluorescent tagging

  • Functional assays measuring GTPase activity

What are the optimal conditions for expressing recombinant gyp10 protein?

Based on available research protocols, recombinant gyp10 can be successfully expressed in E. coli expression systems with the following considerations:

Expression system optimization:

  • Host strain: BL21(DE3) or equivalent strains are commonly used for recombinant protein expression

  • Expression vector: pET-based vectors incorporating a His-tag for purification

  • Induction conditions: IPTG induction (typically 0.5-1.0 mM) at OD600 of 0.6-0.8

  • Temperature: Often optimal at lower temperatures (16-25°C) to enhance solubility

  • Duration: 4-16 hours post-induction

When expressing gyp10, researchers should monitor for inclusion body formation, as GTPase-regulatory proteins can sometimes fold improperly when overexpressed. Experimental approaches to address this include:

  • Coexpression with chaperones

  • Addition of solubility-enhancing tags

  • Optimization of cell lysis conditions

  • Use of detergents during extraction

What purification strategies are most effective for obtaining high-purity recombinant gyp10?

A typical purification workflow for His-tagged recombinant gyp10 involves:

Multi-step purification approach:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole

    • Elution strategy: Imidazole gradient (50-250 mM)

  • Secondary purification: Size exclusion chromatography

    • Buffer optimization: Tris-based buffer with glycerol (typically 50%)

    • Column selection: Superdex 75 or 200 depending on oligomeric state

  • Quality control assessments:

    • SDS-PAGE analysis (target purity >85%)

    • Western blot confirmation

    • Mass spectrometry verification

    • Activity assays to confirm functionality

For long-term storage, purified gyp10 is typically stored in a Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C. Repeated freeze-thaw cycles should be avoided by preparing working aliquots stored at 4°C for up to one week .

How can researchers accurately measure the GTPase-activating function of gyp10?

Several complementary approaches can be used to assess the GTPase-activating function of gyp10:

In vitro biochemical assays:

  • Colorimetric phosphate release assays:

    • Principle: Measures inorganic phosphate released during GTP hydrolysis

    • Readout: Malachite green-based colorimetric detection

    • Controls: Include substrate GTPase alone without gyp10

  • HPLC-based nucleotide analysis:

    • Principle: Direct separation and quantification of GDP and GTP

    • Advantage: High sensitivity and specificity

    • Sample preparation: Requires careful extraction protocols

  • Fluorescence-based assays:

    • Principle: Uses fluorescently labeled GTP analogs

    • Real-time measurement: Allows kinetic analysis

    • Equipment: Requires fluorescence plate reader or spectrofluorometer

In vivo functional analysis:

  • Complementation studies in gyp10-deletion strains

  • Phenotypic analysis of cells expressing mutant versions of gyp10

  • Localization studies using fluorescently tagged gyp10

When designing these experiments, researchers should consider including appropriate controls:

  • Positive control: Known active GAP protein

  • Negative control: Catalytically inactive gyp10 mutant

  • Substrate controls: Testing specificity with different GTPases

What techniques are available for identifying the GTPase targets of gyp10?

Identifying the specific GTPases regulated by gyp10 requires multiple approaches:

Methodological approaches:

  • Affinity capture-based methods:

    • Co-immunoprecipitation with tagged gyp10

    • Pull-down assays using recombinant gyp10 as bait

    • Proximity labeling approaches (BioID, APEX)

  • Systematic screening approaches:

    • In vitro GAP activity assays with purified S. pombe GTPases

    • Yeast two-hybrid screening against GTPase library

    • Mass spectrometry-based interactome analysis

  • Genetic interaction mapping:

    • Synthetic genetic array analysis with gyp10 deletion

    • Suppressor screens in gyp10 mutant backgrounds

    • CRISPR-based screening for genetic interactions

The data from these experiments should be analyzed using:

  • Statistical methods to identify significant interactions

  • Network analysis to place gyp10 in relevant GTPase pathways

  • Validation through orthogonal techniques

What are the advantages of using S. pombe for studying gyp10 function?

S. pombe offers several key advantages as a model organism for investigating gyp10 function:

Experimental advantages of S. pombe:

  • Genetic tractability:

    • Haploid genome facilitates genetic manipulation

    • Well-developed genetic tools (gene deletion, tagging)

    • Simple genotypes with limited genetic redundancy

  • Cellular characteristics:

    • Rod-shaped cells (3-4 μm diameter, 7-14 μm length)

    • Well-characterized cell cycle (extended G2 phase)

    • Defined growth patterns with polar growth

  • Genomic features:

    • Fully sequenced genome (~14.1 million base pairs)

    • Approximately 4,970 protein-coding genes

    • High conservation with mammalian systems

    • 70% of S. pombe genes have human orthologs

  • Technical considerations:

    • Rapid growth (3-hour doubling time)

    • Simple media requirements

    • Established protocols for protein localization studies

When designing experiments in S. pombe, researchers should take advantage of available resources:

  • PomBase database for gene annotation and function

  • Strain collections with systematic gene deletions

  • Protocols for endogenous tagging of proteins

How does the function of gyp10 in S. pombe compare to similar proteins in other model organisms?

To understand the evolutionary context and functional conservation of gyp10:

Comparative analysis framework:

  • Ortholog identification:

    • Bioinformatic analysis using sequence similarity

    • Domain architecture comparison

    • Phylogenetic analysis of related proteins

  • Functional conservation assessment:

    • Complementation studies across species

    • Analysis of conserved interaction partners

    • Comparison of phenotypes in deletion mutants

  • Structural conservation:

    • Alignment of critical catalytic residues

    • Conservation of regulatory domains

    • Analysis of post-translational modification sites

The table below summarizes some comparative aspects between S. pombe gyp10 and GAPs in other model organisms:

OrganismGAP Protein(s)Similarity to gyp10Key Functional Differences
S. cerevisiaeVarious Gyp proteinsDomain architecture conservationDifferent cell division mechanisms
H. sapiensMultiple RabGAPsConservation in catalytic domainsIncreased complexity in interaction networks
C. elegansGAP homologsBasic catalytic mechanismTissue-specific expression patterns
D. melanogasterGAP homologsCore GAP functionsDevelopmental regulation differences

How can gyp10 be used in structural biology studies of GTPase regulation?

Recombinant gyp10 provides opportunities for detailed structural investigations:

Structural biology approaches:

  • X-ray crystallography:

    • Crystallization conditions: Typically involves screening of precipitants, buffers, and additives

    • Co-crystallization: With substrate GTPases in different nucleotide states

    • Resolution targets: ≤2.5Å for detailed mechanistic insights

  • Cryo-electron microscopy:

    • Sample preparation: Vitrification of purified complexes

    • Advantages: Visualization of larger complexes and conformational states

    • Processing workflows: Single particle analysis and classification

  • NMR spectroscopy:

    • Isotopic labeling: 15N, 13C, 2H labeling of recombinant protein

    • Applications: Dynamics studies and interaction mapping

    • Constraints: Size limitations for full protein analysis

  • Small-angle X-ray scattering (SAXS):

    • Purpose: Low-resolution structural information in solution

    • Sample requirements: Highly purified, monodisperse samples

    • Analysis: Determination of molecular shape and conformational changes

When designing structural studies, researchers should consider:

  • Protein engineering to enhance crystallizability

  • Use of truncation constructs to target specific domains

  • Incorporation of stabilizing mutations based on sequence analysis

What role might gyp10 play in cellular processes beyond canonical GTPase regulation?

Recent research suggests GTPase-activating proteins may have functions beyond their canonical roles:

Emerging functional areas:

  • Protein scaffolding:

    • Investigation of interaction partners beyond GTPases

    • Analysis of complex formation using proteomics

    • Functional significance of multi-protein assemblies

  • Cellular localization patterns:

    • High-resolution imaging of tagged gyp10

    • Cell cycle-dependent localization changes

    • Colocalization with cytoskeletal elements or membrane compartments

  • Potential roles in cytokinesis:

    • Given that S. pombe divides by medial fission, gyp10 may contribute to cytokinesis

    • Analysis of localization during cell division

    • Investigation of phenotypes in division plane specification

  • Stress response involvement:

    • Expression changes under various stressors

    • Phenotypic analysis of mutants under stress conditions

    • Integration with stress-responsive signaling pathways

Research methods to investigate these potential functions include:

  • Transcriptomics to identify co-regulated genes

  • Temporal proteomics throughout the cell cycle

  • High-content imaging under various conditions

  • Synthetic genetic array analysis to map genetic interactions

What are common challenges in working with recombinant gyp10 and how can they be addressed?

Researchers working with recombinant gyp10 may encounter several technical challenges:

Common issues and solutions:

  • Low expression levels:

    • Problem: Poor protein yield from expression systems

    • Solutions:

      • Optimize codon usage for expression host

      • Test different promoter systems

      • Evaluate expression in multiple host strains

      • Consider fusion partners that enhance expression

  • Protein insolubility:

    • Problem: Formation of inclusion bodies

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce IPTG concentration (0.1-0.3 mM)

      • Add solubility enhancers to lysis buffer

      • Consider refolding protocols if necessary

  • Protein instability:

    • Problem: Degradation during purification

    • Solutions:

      • Include protease inhibitors in all buffers

      • Maintain cold temperatures throughout purification

      • Add stabilizing agents (glycerol, specific ions)

      • Optimize buffer conditions (pH, ionic strength)

  • Loss of activity:

    • Problem: Purified protein lacks enzymatic function

    • Solutions:

      • Verify protein folding using circular dichroism

      • Ensure cofactors or metal ions are present if required

      • Test activity immediately after purification

      • Optimize storage conditions to maintain functionality

How can researchers validate that their recombinant gyp10 preparation is functionally active?

Multiple complementary approaches should be used to confirm functional activity:

Validation methodology:

  • Biochemical activity assays:

    • GTPase acceleration assays with model substrates

    • Dose-dependent activity measurements

    • Determination of kinetic parameters (kcat, Km)

    • Comparison with positive control GAP proteins

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to evaluate stability

    • Limited proteolysis to verify proper folding

    • Dynamic light scattering for homogeneity analysis

  • Functional complementation:

    • Rescue experiments in gyp10-deletion strains

    • Phenotypic assays relevant to suspected gyp10 function

    • Localization studies with tagged protein versions

A comprehensive validation approach would include:

  • Testing multiple independent protein preparations

  • Using different assay methodologies

  • Including appropriate positive and negative controls

  • Quantitative analysis with statistical evaluation of results

How does gyp10 integrate with known signaling networks in S. pombe?

Understanding gyp10's position in cellular signaling requires systematic investigation:

Network mapping approaches:

  • Interactome analysis:

    • Affinity purification-mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling approaches

    • In silico prediction of interaction partners

  • Genetic interaction mapping:

    • Synthetic genetic array analysis

    • Suppressor/enhancer screens

    • Epistasis analysis with known pathway components

    • CRISPR-based screening approaches

  • Pathway reconstruction:

    • Integration of physical and genetic interaction data

    • Computational modeling of signaling networks

    • Perturbation experiments with targeted inhibitors

    • Time-resolved analysis of signaling events

Researchers should consider examining gyp10's potential role in:

  • Cell polarity establishment

  • Vesicle trafficking pathways

  • Cell cycle regulation

  • Stress response mechanisms

What are the implications of gyp10 research for understanding human disease mechanisms?

While gyp10 is a yeast protein, insights from its study may be relevant to human health:

Translational research considerations:

  • Identification of human orthologs:

    • Sequence-based ortholog prediction

    • Domain architecture comparison

    • Functional conservation assessment

    • Expression pattern analysis

  • Disease association analysis:

    • Examination of human ortholog mutations in disease databases

    • Analysis of expression changes in relevant pathologies

    • Investigation of pathway conservation between yeast and humans

  • Mechanistic insights:

    • Conservation of regulatory mechanisms

    • Structural basis of enzyme function

    • Potential as a model for drug development

    • Understanding of fundamental cellular processes

Given that approximately 70% of S. pombe genes have human orthologs with many associated with human diseases, research on gyp10 may provide insights into:

  • Cellular trafficking disorders

  • Cell division abnormalities

  • Signaling pathway dysregulation

  • Potential therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.