Recombinant Schizosaccharomyces pombe HIG1 domain-containing protein C25B8.07c, mitochondrial (SPAC25B8.07c)

Shipped with Ice Packs
In Stock

Description

Expression Host Organisms

Recombinant versions of the S. pombe HIG1 domain-containing protein C25B8.07c have been successfully produced in multiple expression systems, providing researchers with options tailored to specific experimental requirements. Table 1 summarizes the various expression systems used for this protein:

Expression HostProduct ExamplesKey FeaturesReference
E. coliCSB-EP891627SXV1, RFL5079SFHigh yield, cost-effective, His-tagged options
YeastCSB-YP891627SXV1Post-translational modifications similar to native protein
BaculovirusCSB-BP891627SXV1Complex eukaryotic processing
Mammalian CellCSB-MP891627SXV1Most authentic eukaryotic processing

The choice of expression system depends on the specific requirements of the research application. E. coli expression systems typically offer high yields and cost-effectiveness, while eukaryotic systems may provide more authentic post-translational modifications and protein folding .

Protein Purification and Stability

Recombinant preparations of this protein typically achieve greater than 90% purity as determined by SDS-PAGE analysis . The protein is available in different formulations to ensure stability:

  1. Lyophilized powder form, which provides extended shelf life and simplified shipping

  2. Liquid preparations containing glycerol to prevent freeze-thaw damage

For optimal storage and handling, several recommendations are consistently provided across sources:

  • Long-term storage should be maintained at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freeze-thaw cycles should be avoided to prevent protein degradation

The reconstitution of lyophilized protein typically involves resuspension in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) recommended for long-term storage .

Various buffer compositions are used to maintain protein stability:

  • Tris-based buffer with 50% glycerol

  • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Mitochondrial Membrane Integration

The HIG1 domain-containing protein C25B8.07c is definitively characterized as a mitochondrial protein, specifically integrated into the mitochondrial membrane as a multi-pass membrane protein . This subcellular localization is consistent with its role in mitochondrial functions and suggests that the protein traverses the mitochondrial membrane multiple times, with domains extending into different compartments of the organelle.

The protein's membrane integration positions it to participate in processes that occur at the mitochondrial membrane interface, such as:

  • Maintaining membrane potential

  • Facilitating molecular transport

  • Organizing respiratory complexes

  • Contributing to mitochondrial morphology

Role in Mitochondrial Respiratory Chain Supercomplex Assembly

One of the most significant functional roles identified for this protein is its involvement in mitochondrial respiratory chain supercomplex assembly . The respiratory chain, also known as the electron transport chain, consists of multiple protein complexes embedded in the inner mitochondrial membrane that work together to generate the proton gradient necessary for ATP synthesis.

These respiratory complexes can associate into larger supramolecular assemblies called supercomplexes, which are believed to enhance the efficiency of electron transfer and reduce the production of reactive oxygen species. The HIG1 domain-containing protein C25B8.07c appears to play a role in organizing or stabilizing these higher-order structures, which is consistent with its mitochondrial membrane localization and suggests importance in cellular energy metabolism .

Identified Protein-Protein Interactions

The HIG1 domain-containing protein C25B8.07c has been found to interact with several other proteins in S. pombe, providing insights into its functional network. These interactions have been primarily identified through genetic studies and include:

Interacting ProteinGene NameInteraction TypeReference
HSV2_SCHPOatg1803Genetic
YBPD_SCHPOSPBC16H5.13Genetic
HIR1_SCHPOhip1Genetic

These interactions suggest that the HIG1 domain-containing protein C25B8.07c functions within a network of proteins involved in diverse cellular processes . The interaction with atg1803 (HSV2_SCHPO) is particularly notable as autophagy-related genes are typically involved in cellular degradation and recycling processes, which can be connected to mitochondrial quality control mechanisms.

The interaction with hip1 (HIR1_SCHPO), a histone chaperone, suggests potential connections to chromatin regulation and possibly nuclear-mitochondrial communication pathways. These genetic interactions provide valuable clues about the broader functional context of this protein and highlight the interconnected nature of cellular pathways.

Integration with Cellular Stress Response

Given its classification as part of the HIG1 (Hypoxia-Induced Gene) family, this protein may participate in cellular responses to low oxygen conditions . In hypoxic environments, mitochondrial function often requires modulation to adapt to reduced oxygen availability, and HIG1 family proteins could participate in this adaptation process.

The potential dual role in both respiratory chain organization and hypoxia response suggests that this protein may serve as an integrator of cellular stress signals and mitochondrial function, potentially helping to optimize energy production under varying environmental conditions.

Experimental Applications

The commercial availability of recombinant Schizosaccharomyces pombe HIG1 domain-containing protein C25B8.07c from multiple sources and in various forms underscores its value as a research tool . These recombinant proteins enable diverse experimental applications:

  1. Structural Studies: Purified recombinant protein can be used for crystallography, NMR spectroscopy, or cryo-electron microscopy to determine its three-dimensional structure.

  2. Interaction Mapping: The protein can be employed in various binding assays to identify and characterize its interaction partners, including pull-down experiments, co-immunoprecipitation, or surface plasmon resonance.

  3. Functional Assays: Recombinant protein can be incorporated into in vitro systems to study its role in processes such as supercomplex assembly or mitochondrial membrane organization.

  4. Antibody Development: The protein can serve as an antigen for generating specific antibodies, which can then be used for detection, localization, or functional studies of the endogenous protein.

  5. Comparative Studies: The recombinant protein enables comparative analyses with homologous proteins from other species to assess evolutionary conservation and divergence.

Broader Scientific Significance

The study of this mitochondrial protein has implications beyond S. pombe biology. Mitochondrial function is highly conserved across eukaryotes, and insights gained from studying this protein could have broader implications for understanding fundamental aspects of mitochondrial biology in higher organisms, including humans.

Research on this protein contributes to our understanding of:

  • Mitochondrial membrane protein organization and function

  • Respiratory chain supercomplex assembly and regulation

  • Cellular adaptation to hypoxic conditions

  • Potential connections between mitochondrial function and other cellular processes

Given the central role of mitochondria in cellular energy production and their involvement in numerous human diseases, research on proteins like the HIG1 domain-containing protein C25B8.07c may ultimately contribute to our understanding of mitochondrial dysfunction in pathological conditions.

Knowledge Gaps

Despite the commercial availability of recombinant versions of this protein and some insights into its cellular context, significant gaps remain in our understanding:

  1. The precise molecular mechanism by which this protein contributes to supercomplex assembly is not fully elucidated.

  2. Detailed structural information, particularly regarding its membrane topology and domain organization, is limited.

  3. The regulatory mechanisms controlling its expression and activity, especially under hypoxic conditions, remain to be characterized.

  4. The complete set of interaction partners and their functional significance requires further investigation.

  5. Potential post-translational modifications that might regulate its function have not been extensively documented .

Future Research Opportunities

These knowledge gaps present numerous opportunities for future research:

  1. High-resolution structural studies to determine the three-dimensional conformation and membrane integration of the protein.

  2. Comprehensive interaction mapping to identify all proteins that associate with HIG1 domain-containing protein C25B8.07c.

  3. Functional studies using gene deletion, mutation, or overexpression to determine the consequences of altered protein levels or activity on mitochondrial function.

  4. Investigation of its regulation and role in hypoxia response pathways, particularly how it contributes to mitochondrial adaptation to low oxygen conditions.

  5. Comparative studies with HIG1 domain-containing proteins in other organisms to assess evolutionary conservation and divergence of function.

  6. Exploration of potential relevance to human health through identification and characterization of human homologs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPAC25B8.07c; HIG1 domain-containing protein C25B8.07c, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC25B8.07c
Target Protein Sequence
MSSKLPKKSEENLELPTFPASEESLSRSEKLKYVFVRNPFIPLGCLMTVGTFLASGYYIR RENHLMANKFMRYRVMSQGFTLAALAFSVLFIGPPRREAPSNSSGSINSEIKK
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is SPAC25B8.07c and what is its significance in S. pombe?

SPAC25B8.07c is a mitochondrial protein in Schizosaccharomyces pombe (fission yeast) that contains a HIG1 (Hypoxia Induced Gene 1) domain. The full-length protein consists of 113 amino acids and is classified as a mitochondrial protein . The protein's annotation as a HIG1 domain-containing protein suggests potential roles in hypoxia response and mitochondrial function, similar to HIG1 family proteins in other organisms . S. pombe serves as an excellent model organism for studying mitochondrial proteins due to its conserved cellular mechanisms with higher eukaryotes .

What is known about the subcellular localization of SPAC25B8.07c?

SPAC25B8.07c is annotated as a mitochondrial protein based on sequence analysis and prediction algorithms . This localization is consistent with other HIG1 domain-containing proteins across species, which are typically found in the mitochondrial compartment. Based on studies of HIG1 domain proteins in other organisms, SPAC25B8.07c likely localizes specifically to the mitochondrial inner membrane where it may interact with other mitochondrial proteins . Experimental confirmation of this localization would typically involve fluorescently-tagged protein expression and microscopy techniques.

What functions might SPAC25B8.07c perform based on homology to other HIG1 domain proteins?

While direct experimental evidence for SPAC25B8.07c function is limited in the current literature, its classification as a HIG1 domain-containing protein allows for functional predictions based on homology. Research on the mammalian homolog Higd1a suggests several potential functions:

  • Mitochondrial membrane integrity: Higd1a contributes to the integrity of the mitochondrial inner membrane by interacting with OPA1 (Optic Atrophy 1) and preventing excessive processing of the long OPA1 isoform (L-OPA1) to the short isoform (S-OPA1) .

  • Anti-apoptotic activity: Studies show that Higd1a prevents cytochrome c release from mitochondria and inhibits the activation of caspases 3 and 9, thereby protecting cells from apoptosis under stress conditions .

  • Hypoxia response: As suggested by its domain classification, SPAC25B8.07c may play a role in cellular adaptation to hypoxic conditions, potentially through regulation of mitochondrial function .

Based on these homologous functions, SPAC25B8.07c may serve as a stress-responsive protein that helps maintain mitochondrial integrity in S. pombe under challenging environmental conditions.

How does SPAC25B8.07c potentially contribute to mitochondrial homeostasis?

The contribution of SPAC25B8.07c to mitochondrial homeostasis can be inferred from studies of related HIG1 domain proteins. In mammalian systems, Higd1a:

  • Maintains mitochondrial fusion: By interacting with OPA1 via its N-terminal domain and preventing excessive cleavage of L-OPA1 to S-OPA1, thereby preserving proper mitochondrial morphology and function .

  • Prevents mitochondrial membrane permeabilization: Under stress conditions, it helps maintain the integrity of the mitochondrial membrane, preventing the release of pro-apoptotic factors like cytochrome c .

  • Regulates energy metabolism: Through interactions with components of the electron transport chain, it may modulate mitochondrial respiration in response to cellular needs.

By analogy, SPAC25B8.07c might perform similar functions in S. pombe mitochondria, potentially serving as a regulator of mitochondrial dynamics and stress response pathways.

What expression systems are available for producing recombinant SPAC25B8.07c?

Multiple expression systems are available for producing recombinant SPAC25B8.07c, each with distinct advantages depending on research needs:

Expression HostTag OptionsFeaturesBest ForReference
E. coliHis-tag, optional biotinylationHigh yield, economicalIn vitro studies, antibody production
YeastVarious tags possiblePost-translational modificationsFunctional studies requiring eukaryotic processing
BaculovirusVarious tags possibleComplex folding, high purityStructural studies, enzymatic assays
Mammalian cellsVarious tags possibleMost native-like modificationsInteraction studies with mammalian proteins

When designing experiments with recombinant SPAC25B8.07c, researchers should consider that the protein is typically stored in buffer containing glycerol and should be maintained at -20°C for long-term storage or at 4°C for up to one week for working aliquots .

What genetic manipulation strategies can be used to study SPAC25B8.07c function in vivo?

Several genetic approaches are available for studying SPAC25B8.07c function in S. pombe:

  • Gene deletion/knockout: The creation of SPAC25B8.07c deletion strains allows for phenotypic analysis under various conditions, including stress responses, mitochondrial function, and cell viability assays .

  • Rapid inducible expression systems: The urg1 inducible system allows for quick transcriptional induction in S. pombe, with expression levels peaking within 30 minutes after inducer addition, making it superior to the traditional nmt1 promoter system which requires 14-20 hours for full induction .

  • Synthetic Genetic Array (SGA) screening: This approach can identify genetic interactions between SPAC25B8.07c and other genes, helping to place it within functional networks .

  • Domain swap experiments: Replacing specific regions (like the N-terminal domain) with corresponding regions from other HIG1 proteins can help determine the functional importance of different protein segments .

  • Tagging strategies: Adding epitope or fluorescent tags allows for visualization of protein localization, monitoring expression levels, and facilitating protein interaction studies .

What methodologies are most effective for studying SPAC25B8.07c involvement in stress response?

To investigate SPAC25B8.07c's role in cellular stress response, particularly hypoxia, several methodologies are recommended:

  • Controlled hypoxia experiments: Exposing wild-type and SPAC25B8.07c mutant S. pombe cells to defined hypoxic conditions while monitoring cellular phenotypes, mitochondrial function, and survival rates .

  • Transcriptional profiling: RNA-seq or microarray analysis comparing gene expression patterns between wild-type and SPAC25B8.07c mutant strains under normal and stress conditions can reveal downstream effects of SPAC25B8.07c function .

  • Precision Run-On sequencing (PRO-Seq): This technique allows for high-resolution mapping of transcriptionally engaged RNA polymerase, providing insights into immediate transcriptional responses to stress conditions .

  • Mitochondrial assays: Measuring parameters such as mitochondrial membrane potential, respiration rate, and ATP production in response to stress conditions can reveal functional impacts of SPAC25B8.07c manipulation .

  • Protein interaction studies: Co-immunoprecipitation experiments under normal and stress conditions can identify stress-specific protein interactions that might explain SPAC25B8.07c's role in stress response .

How might SPAC25B8.07c interact with other mitochondrial proteins?

Based on studies of homologous HIG1 domain proteins, SPAC25B8.07c likely engages in protein-protein interactions that mediate its mitochondrial functions. Potential interaction mechanisms include:

  • N-terminal domain interactions: The N-terminal region of HIG1 domain proteins is crucial for protein-protein interactions. In mammalian Higd1a, the N-terminal 26 amino acids are essential for interaction with OPA1 and for mediating its protective effects .

  • Cytochrome c binding: Higd1a has been shown to bind directly to cytochrome c, potentially preventing its release during stress conditions. SPAC25B8.07c might similarly interact with S. pombe cytochrome c or other components of the electron transport chain .

  • Membrane protein complexes: As a predicted mitochondrial membrane protein, SPAC25B8.07c likely participates in membrane protein complexes that regulate mitochondrial structure and function.

Co-immunoprecipitation followed by mass spectrometry would be an effective approach to identify the interaction partners of SPAC25B8.07c in S. pombe mitochondria.

What is known about the evolutionary conservation of SPAC25B8.07c across species?

While the search results don't provide comprehensive information about the evolutionary conservation of SPAC25B8.07c specifically, HIG1 domain-containing proteins are found across diverse eukaryotic lineages:

  • Domain conservation: The HIG1 domain represents a functionally important module that has been maintained throughout evolution, suggesting conserved roles in mitochondrial function and stress response .

  • Functional conservation: Studies on HIG1 domain proteins across species from yeast to mammals indicate conserved roles in mitochondrial homeostasis and stress response, particularly hypoxia adaptation .

  • Structural features: The importance of the N-terminal region for function appears to be a conserved feature of HIG1 domain proteins, as demonstrated by studies showing that deletion of this region abrogates the protective functions of mammalian Higd1a .

Comparative genomic analyses using SPAC25B8.07c as a query against other fungal genomes and more distant eukaryotes would provide more detailed information about its evolutionary conservation.

How can advanced imaging techniques be applied to study SPAC25B8.07c dynamics?

Advanced imaging techniques offer powerful approaches to investigate SPAC25B8.07c dynamics and function in living cells:

  • Super-resolution microscopy: Techniques such as Structured Illumination Microscopy (SIM) or Stimulated Emission Depletion (STED) microscopy can provide detailed visualization of SPAC25B8.07c localization within mitochondrial subcompartments.

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can assess the mobility and dynamics of fluorescently-tagged SPAC25B8.07c within mitochondrial membranes.

  • Förster Resonance Energy Transfer (FRET): By tagging SPAC25B8.07c and potential interaction partners with appropriate fluorophore pairs, FRET can detect direct protein-protein interactions in living cells.

  • Live-cell time-lapse imaging: This approach can monitor changes in SPAC25B8.07c localization or abundance in response to stress conditions or other cellular perturbations.

  • Correlative Light and Electron Microscopy (CLEM): This technique combines the specificity of fluorescence microscopy with the high resolution of electron microscopy, allowing precise localization of SPAC25B8.07c within mitochondrial ultrastructure.

Implementation of these techniques requires generating S. pombe strains expressing fluorescently-tagged SPAC25B8.07c, ideally under control of its native promoter to maintain physiological expression levels.

What are common challenges in working with recombinant SPAC25B8.07c and how can they be addressed?

Researchers working with recombinant SPAC25B8.07c may encounter several challenges:

  • Protein solubility: As a mitochondrial membrane protein, SPAC25B8.07c may have hydrophobic regions that reduce solubility. Solutions include:

    • Using mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin

    • Expression with solubility tags such as MBP or SUMO

    • Optimization of buffer conditions with glycerol and salt

  • Proper folding: Ensuring native-like folding is crucial for functional studies. Approaches include:

    • Expression in eukaryotic systems for complex proteins

    • Inclusion of specific cofactors or binding partners during purification

    • Validation of protein folding using circular dichroism spectroscopy

  • Storage stability: Maintaining protein activity during storage requires:

    • Addition of glycerol (typically 50%) to storage buffer

    • Avoiding repeated freeze-thaw cycles

    • Aliquoting protein solutions before freezing

    • For short-term use, storage at 4°C for up to one week

  • Functional validation: Confirming that recombinant protein retains native-like properties through:

    • Binding assays with known interaction partners

    • Structural characterization compared to predictions

    • Activity assays, if enzymatic function is known

How can researchers optimize gene expression analyses for SPAC25B8.07c studies?

For effective gene expression analysis involving SPAC25B8.07c, researchers should consider:

  • RNA isolation optimization:

    • Use specialized protocols for S. pombe that account for its cell wall properties

    • Include controls to ensure complete lysis and RNA recovery

    • Verify RNA integrity using bioanalyzer or gel electrophoresis

  • Library preparation considerations:

    • Select appropriate RNA-seq library preparation methods based on research questions

    • Include spike-in controls for normalization

    • Consider strand-specific protocols for detailed transcriptional analysis

  • Advanced expression analysis techniques:

    • Precision Run-On sequencing (PRO-Seq) for studying nascent transcription and immediate transcriptional responses

    • Implementation of nuclear run-on and RNA extraction protocols optimized for S. pombe

    • Specialized library preparation for PRO-Seq analysis

  • Real-time PCR optimization:

    • Design primers specific to SPAC25B8.07c and potential target genes

    • Validate primer efficiency and specificity

    • Include appropriate reference genes for normalization

    • Use multiple biological and technical replicates for robust results

What considerations are important when designing genetic interaction screens involving SPAC25B8.07c?

When designing genetic interaction screens to investigate SPAC25B8.07c function:

  • Screen selection:

    • Synthetic Genetic Array (SGA) approaches can identify genes that functionally interact with SPAC25B8.07c

    • Consider both negative genetic interactions (synthetic lethality or sickness) and positive genetic interactions (suppression)

  • Control considerations:

    • Include wild-type controls and single mutant controls

    • Use marker gene controls to validate screen performance

    • Consider temperature-sensitive alleles for essential genes

  • Phenotypic readouts:

    • Select appropriate phenotypic readouts based on expected SPAC25B8.07c function

    • Consider growth rate, stress resistance, mitochondrial function, or specific cellular processes

    • Use quantitative measurements where possible for statistical robustness

  • Data analysis:

    • Apply appropriate statistical methods to identify significant genetic interactions

    • Cluster genetic interactions to identify functional modules

    • Validate key interactions with targeted follow-up experiments

  • Integration with existing data:

    • Compare results with previously identified genetic interactions in related pathways

    • Use bioinformatic approaches to place SPAC25B8.07c in functional networks

    • Consider evolutionary conservation of identified interactions

What are promising avenues for future research on SPAC25B8.07c and related proteins?

Several promising research directions for SPAC25B8.07c include:

  • Comprehensive interactome mapping:

    • Identification of all protein interaction partners of SPAC25B8.07c under normal and stress conditions

    • Characterization of the dynamics of these interactions in response to environmental changes

    • Comparison with interactomes of HIG1 domain proteins in other species

  • Structural biology approaches:

    • Determination of the three-dimensional structure of SPAC25B8.07c using X-ray crystallography or cryo-electron microscopy

    • Structure-function analysis through mutagenesis of key residues

    • Investigation of conformational changes under different conditions

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to position SPAC25B8.07c within cellular stress response pathways

    • Mathematical modeling of mitochondrial dynamics incorporating SPAC25B8.07c function

  • Translational research perspectives:

    • Investigation of HIG1 domain proteins in human disease contexts

    • Development of interventions targeting HIG1 domain proteins for therapeutic purposes

    • Exploration of potential biomarker applications in stress-related conditions

These research directions would significantly advance our understanding of SPAC25B8.07c function and its relevance to fundamental cellular processes and potential medical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.