Recombinant Schizosaccharomyces pombe Meiotic expression up-regulated protein 24 (meu24)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Schizosaccharomyces pombe Meiotic Expression Up-Regulated Protein 24 (Meu24), also known as wtf11 or SPCC1281.08, is a meiosis-specific protein encoded by the meu24 gene. First identified through subtractive hybridization screens targeting meiosis-induced transcripts , Meu24 is part of a cluster of genes (meu) whose expression is tightly regulated during sexual differentiation in fission yeast. The recombinant form of Meu24 is commercially available as a His-tagged protein expressed in E. coli, facilitating its use in biochemical and functional studies .

Functional Role in Meiosis

Meu24 is transcriptionally upregulated during meiosis and sporulation in S. pombe. Its expression is dependent on the meiosis-specific transcription factor mei4+, which binds forkhead DNA motifs in target promoters . While the exact biochemical function of Meu24 remains undefined, its meiosis-specific expression and structural features suggest roles in:

  • Chromosome dynamics: Potential involvement in homologous recombination or segregation, given its expression timing during meiosis .

  • Membrane organization: Hydrophobic domains may mediate interactions with lipid bilayers or meiotic organelle membranes .

Regulatory Context

Regulatory FactorMechanismSource
mei4+Direct transcriptional activation via forkhead DNA-binding domain
Sporulation signalsInduced by nitrogen starvation in diploid cells undergoing azygotic meiosis

Research Applications and Experimental Findings

The recombinant Meu24 protein serves as a critical tool for studying meiotic processes and protein interactions. Key applications include:

Production and Purification

ParameterValue/Description
Expression HostE. coli
TagN-terminal His-tag (confirmed) ; tag type may vary by production batch
Storage-20°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw
Availability50 µg vials; custom quantities upon request

Functional Studies

  • Antibody Development: Used as an antigen for generating anti-Meu24 antibodies in ELISA-based assays .

  • Interaction Mapping: Potential use in pull-down assays to identify meiotic protein partners, though no direct interactions have been reported .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
wtf11; meu24; SPCC1281.08; Wtf element wtf11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
meu24
Target Protein Sequence
MNSNYVPLTSSVDVEEKMESENGVDLGNDIDLEKGLPLKYNSENESGLPSNSASSYLINP DPTMDLEAQTFNHNESTTSVGHDNSNSPPKCRKTCSSNKVYSNEVPLLFVFVISISIVCI FDLVIFGCLQYNMVSMDDLHVMQRLSWFCASLALLFILMRYYDFWTKACKDGIKHIFKKW KNTPLAFLQVLIFNIIGFFVRKGLKDSFGEQWGLKTSLFAHVSFATMSIFIFIFETLKPG SCSVDWIARILKAVVYFLEDSDEL
Uniprot No.

Target Background

Function
May act in meiotic drive.
Database Links
Protein Families
WTF family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the meu24 protein and what is its significance in S. pombe?

Meiotic expression up-regulated protein 24 (meu24) is a protein encoded by the meu24 gene (also known as wtf11) in Schizosaccharomyces pombe. The protein is significantly upregulated during meiosis, suggesting its important role in sexual reproduction and spore formation in fission yeast. The protein is encoded by the ORF SPCC1281.08 and has been assigned the UniProt accession number Q96WS1 . Based on its sequence characteristics and expression pattern, meu24 is considered part of the meiotic regulatory network that coordinates the complex cellular events during sexual reproduction in S. pombe.

What structural characteristics define meu24 protein?

Meu24 is characterized by a 264 amino acid sequence with several notable structural features. Analysis of its amino acid sequence (MNSNYVPLTSSVDVEEKMESENGVDLGNDIDLEKGLPLKYNSENESGLPSNSASSYLINPDPTMDLEAQTFNHNESTTSVGHDNSNSPPKCRKTCSSNKVYSNEVPLLFVFVISISIVCIFDLVIFGCLQYNMVSMDDLHVMQRLSWFCASLALLFILMRYYDFWTKACKDGIKHIFKKWKNTPLAFLQVLIFNIIGFFVRKGLKDSFGEQWGLKTSLFAHVSFATMSIFIFIFETLKPGSCSVDWIARILKAVVYFLEDSDEL) reveals hydrophobic regions consistent with transmembrane domains, particularly in the central portion of the protein . Secondary structure prediction indicates the presence of both α-helical and β-sheet elements. The C-terminal region contains several charged residues that may participate in protein-protein interactions or DNA binding functions. These structural elements suggest meu24 likely functions as a membrane-associated protein with specific roles during meiotic processes.

How is meu24 expression regulated during the cell cycle?

Meu24 protein expression is tightly regulated during the S. pombe cell cycle, with significant upregulation during meiosis. Transcriptional analysis shows that the meu24 gene contains meiosis-specific regulatory elements in its promoter region that respond to the master regulators of sexual development in fission yeast. The gene expression is likely controlled by the Mei4 transcription factor, a key regulator of middle meiotic genes in S. pombe. Experimental approaches to study this regulation include RT-PCR, Northern blotting, and reporter gene assays using the meu24 promoter fused to fluorescent proteins. Time-course experiments during nitrogen starvation-induced meiosis show a characteristic expression pattern with peak levels occurring during the middle stages of meiosis.

What are the optimal conditions for expression and purification of recombinant meu24?

The optimal expression and purification of recombinant meu24 requires careful consideration of expression systems, tags, and purification strategies. The following methodological approach is recommended:

Expression system selection: E. coli BL21(DE3) or Rosetta strains are commonly used for initial attempts, though yeast expression systems (particularly S. cerevisiae) may provide better folding for this eukaryotic protein. For membrane-associated proteins like meu24, expression in insect cells using baculovirus systems can also be considered for proper folding and post-translational modifications.

Induction conditions: For E. coli systems, expression at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) often improves solubility. The optimal conditions should be determined through small-scale expression trials analyzing different temperatures, induction times, and inducer concentrations.

Purification strategy: A multi-step purification approach is recommended:

  • Affinity chromatography using an appropriate tag (His6, GST, or MBP)

  • Ion exchange chromatography

  • Size exclusion chromatography as a polishing step

Buffer composition: For membrane-associated proteins like meu24, inclusion of mild detergents (0.1% DDM or 0.5% CHAPS) in the lysis and purification buffers may improve solubility . The final storage buffer (Tris-based with 50% glycerol) helps maintain stability during frozen storage.

How can researchers verify the structural integrity and activity of purified recombinant meu24?

Verification of structural integrity and functional activity of purified recombinant meu24 requires multiple complementary approaches:

Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Thermal shift assays to assess protein stability

  • Limited proteolysis to confirm proper folding

  • Dynamic light scattering (DLS) to evaluate homogeneity and aggregation state

Functional verification:

  • Lipid binding assays to confirm membrane association properties

  • In vitro interaction studies with potential binding partners identified through yeast two-hybrid or co-immunoprecipitation studies

  • Meiosis-specific activity assays in S. pombe cell extracts

A critical step is comparing the recombinant protein's properties with those of the native protein isolated from meiotically induced S. pombe cells. Western blotting with antibodies specific to meu24 can confirm the correct size and immunoreactivity of the recombinant protein compared to the endogenous form.

What advanced imaging techniques are suitable for studying meu24 localization during meiosis?

Advanced imaging approaches for studying meu24 localization during meiosis include:

Super-resolution microscopy: Techniques such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED) microscopy, or Photo-Activated Localization Microscopy (PALM) can overcome the diffraction limit to provide detailed localization data at sub-cellular resolution.

Live-cell imaging: Using meu24 fused to photoactivatable or photoswitchable fluorescent proteins enables tracking of its dynamic localization throughout the meiotic process. Time-lapse imaging with spinning disk confocal microscopy provides the temporal resolution needed to capture rapid changes in localization.

Correlative Light and Electron Microscopy (CLEM): This technique combines the specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy, allowing precise localization of meu24 in relation to membrane structures and meiotic chromosomes.

Multi-color imaging: Co-localization studies with markers for specific subcellular compartments (nuclear envelope, endoplasmic reticulum, plasma membrane) help define the precise localization and trafficking of meu24 during different meiotic stages.

Sample preparation: For S. pombe cells undergoing synchronous meiosis, gentle fixation methods (low concentration formaldehyde) followed by spheroplasting is recommended to preserve delicate meiotic structures while allowing antibody penetration.

How should experiments be designed to investigate potential binding partners of meu24?

A comprehensive experimental design to identify and validate meu24 binding partners should employ multiple complementary approaches:

Primary screening methods:

  • Yeast two-hybrid (Y2H) screening using meu24 as bait against a meiotic S. pombe cDNA library

  • Affinity purification coupled with mass spectrometry (AP-MS) using tagged meu24 expressed during meiosis

  • Proximity-dependent biotin identification (BioID) with meu24 fused to a biotin ligase

Validation approaches:

  • Co-immunoprecipitation with antibodies against endogenous meu24

  • Pull-down assays using recombinant meu24 protein

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) in live cells

Interaction domain mapping:

  • Creation of truncated constructs of meu24 to identify specific interaction domains

  • Site-directed mutagenesis of conserved residues within predicted interaction motifs

Functional studies:

  • Genetic interaction analysis using double mutants

  • Phenotypic analysis of binding partner deletion strains during meiosis

This multi-layered approach allows for high-confidence identification of physiologically relevant binding partners while minimizing false positives that can occur with any single method.

What are common challenges in studying meu24 and how can they be overcome?

Researchers studying meu24 often encounter several significant challenges, along with their recommended solutions:

Membrane protein expression issues:

  • Challenge: Low expression yields and inclusion body formation

  • Solution: Use specialized expression vectors with solubility-enhancing fusion partners (MBP, SUMO); optimize codon usage for the expression host; employ membrane protein-specific expression systems (C43(DE3) E. coli strain)

Protein instability:

  • Challenge: Rapid degradation during purification

  • Solution: Include protease inhibitor cocktails; perform purification at 4°C; add stabilizing agents such as glycerol or specific lipids

Functional assay development:

  • Challenge: Lack of known enzymatic activity for direct assays

  • Solution: Develop indirect functional assays based on binding properties; use cellular phenotypic assays in meu24 deletion strains complemented with mutant variants

Specific antibody generation:

  • Challenge: Difficulty in generating specific antibodies due to low immunogenicity

  • Solution: Use multiple peptide antigens from different regions of meu24; purify antibodies against recombinant protein fragments; validate specificity using knockout strains

Synchronizing meiosis in S. pombe cultures:

  • Challenge: Achieving high-efficiency synchronous meiosis for temporal studies

  • Solution: Optimize nitrogen starvation protocols; use temperature-sensitive pat1 mutants for controlled meiotic induction; employ flow cytometry to monitor progression

What methods are effective for analyzing post-translational modifications of meu24?

Analysis of post-translational modifications (PTMs) of meu24 requires sophisticated analytical approaches:

Mass spectrometry-based approaches:

  • Bottom-up proteomics with enrichment strategies for specific PTMs (phosphopeptide enrichment using TiO2, enrichment of glycopeptides using lectins)

  • Top-down proteomics for intact protein analysis to maintain PTM connectivity information

  • Targeted multiple reaction monitoring (MRM) for quantitative analysis of specific modified peptides

Site-specific analysis techniques:

  • Phospho-specific antibodies for Western blotting

  • Phos-tag SDS-PAGE for mobility shift detection of phosphorylated species

  • ProQ Diamond staining for phosphoprotein detection

In vivo labeling approaches:

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for quantitative comparison of modification states

  • Chemical labeling strategies for enrichment of modified proteins

Bioinformatic analysis:

  • Prediction algorithms for PTM sites based on consensus sequences

  • Comparative analysis across species to identify conserved modification sites

Functional verification:

  • Site-directed mutagenesis of predicted modification sites followed by functional assays

  • Use of inhibitors targeting specific modifying enzymes to assess PTM importance

How can protein-protein interaction networks involving meu24 be comprehensively mapped?

Mapping protein-protein interaction networks involving meu24 requires integrating multiple experimental approaches with computational analyses:

High-throughput experimental approaches:

  • Tandem affinity purification followed by mass spectrometry (TAP-MS)

  • Protein fragment complementation assays (PCA)

  • Membrane yeast two-hybrid systems optimized for membrane proteins

  • BioID or APEX proximity labeling to capture transient interactions

Computational network analysis:

  • Integration of experimental data with predicted interactions based on structural homology

  • Network visualization using tools like Cytoscape

  • Gene Ontology enrichment analysis to identify biological processes represented in the network

  • Cross-species network analysis to identify evolutionarily conserved interactions

Validation and refinement:

  • Co-localization studies using advanced microscopy

  • FRET/FLIM analysis for selected interaction pairs

  • Targeted protein complex immunoprecipitation

  • Reciprocal tagging approaches to confirm interactions

Time-resolved network analysis:

  • Sampling at defined time points during meiotic progression

  • Quantitative proteomics to measure changes in interaction strength

  • Correlation with meu24 phosphorylation states or other PTMs

How should researchers interpret contradictory data regarding meu24 function?

When faced with contradictory data regarding meu24 function, researchers should follow these systematic approaches:

Critical evaluation of experimental conditions:

  • Compare experimental setups including strain backgrounds, growth conditions, and synchronization methods

  • Assess the sensitivity and specificity of detection methods used

  • Evaluate potential off-target effects in genetic manipulation studies

Technical validation:

  • Reproduce key experiments using alternative methodologies

  • Vary experimental parameters systematically to identify condition-dependent effects

  • Use multiple independent clones/strains to rule out clone-specific artifacts

Biological context considerations:

  • Examine potential redundancy with paralogous proteins

  • Consider compensatory mechanisms that may mask phenotypes

  • Analyze results in the context of the specific meiotic stage being studied

Reconciliation strategies:

  • Develop working models that accommodate seemingly contradictory observations

  • Test models with targeted experiments designed to distinguish between alternative hypotheses

  • Consider that contradictions may reveal novel biological complexity rather than experimental error

Computational approaches:

  • Meta-analysis combining datasets from multiple studies

  • Bayesian approaches to weight evidence based on methodological strength

  • Network-based analyses to place contradictory observations in broader pathway contexts

What computational tools are most effective for predicting meu24 structure-function relationships?

Computational analysis of meu24 structure-function relationships can utilize multiple complementary tools:

Protein structure prediction:

  • AlphaFold2 or RoseTTAFold for high-confidence 3D structure prediction

  • TMHMM, TOPCONS for transmembrane domain prediction

  • SignalP for signal peptide prediction

  • PredMP for membrane protein topology prediction

Functional element identification:

  • ELM (Eukaryotic Linear Motif) resource for short functional motifs

  • PFAM domain analysis

  • ConSurf for identification of evolutionarily conserved regions

  • PrDOS for prediction of intrinsically disordered regions

Molecular simulation approaches:

  • Molecular dynamics simulations in membrane environments

  • Monte Carlo simulations of conformational transitions

  • Brownian dynamics for modeling diffusion-limited interactions

Structure-based functional prediction:

  • 3DLigandSite for binding site prediction

  • COACH for protein-protein interaction site prediction

  • FTSite for fragment-based functional site identification

What key parameters should be included in experimental data tables for meu24 studies?

The following table outlines essential parameters that should be included in experimental data tables for comprehensive meu24 studies:

Parameter CategorySpecific ParametersImportance
Expression ConditionsExpression system, Inducer concentration, Temperature, DurationCritical for reproducibility of recombinant protein production
Purification ParametersBuffer composition, pH, Salt concentration, Detergent type/concentration, Chromatography conditionsEnables comparison between different purification approaches
Protein CharacteristicsMolecular weight, Isoelectric point, Extinction coefficient, Secondary structure content (% α-helix, β-sheet)Provides baseline biophysical properties for quality control
Stability MetricsThermal stability (Tm), pH stability range, Time-dependent activity lossInforms storage conditions and experimental design
Binding PropertiesKd values for interaction partners, Lipid binding specificity, Binding stoichiometryQuantifies functional interactions for comparative analyses
Meiotic ExpressionTiming of expression peak, Expression level relative to vegetative cells, Co-expressed proteinsContextualizes biological role in meiotic progression
Localization DataSubcellular compartment percentages, Co-localization coefficients, Temporal dynamicsProvides spatial context for functional interpretation
Mutant PhenotypesSporulation efficiency, Meiotic progression timing, Chromosome segregation metricsQuantifies functional impact of meu24 perturbation

How will emerging technologies advance our understanding of meu24 function in the coming years?

Emerging technologies will significantly advance our understanding of meu24 function through multiple innovative approaches:

Cryo-electron microscopy:
Single-particle cryo-EM and cryo-electron tomography will enable determination of meu24 structure in native membrane environments, potentially revealing conformational states relevant to meiotic function that are difficult to capture with traditional structural biology methods.

Gene editing technologies:
CRISPR-Cas systems with increased specificity will allow precise modification of endogenous meu24, including introduction of site-specific mutations, fluorescent tags at the genomic locus, and conditional degron tags for temporal control of protein levels during specific meiotic stages.

Single-cell technologies:
Single-cell RNA-seq and proteomics will reveal cell-to-cell variability in meu24 expression and function during meiotic progression, potentially identifying subpopulations with distinct expression patterns that may be masked in bulk analyses.

In situ structural biology:
Techniques like cryo-electron tomography combined with focused ion beam milling will allow visualization of meu24 in its native cellular context, revealing its organization relative to meiotic structures like the synaptonemal complex or spindle apparatus.

Spatial transcriptomics/proteomics:
These approaches will map the subcellular distribution of meu24 mRNA and protein with unprecedented resolution, potentially revealing localized translation or function in specific cellular compartments during meiosis.

Synthetic biology approaches: Engineered orthogonal systems will allow testing of meu24 function in simplified contexts, potentially reconstituting minimal functional units to understand the core activities without the complexity of the full meiotic program.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.