Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 110 protein (mug110)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mug110; SPBC2G2.10c; Meiotically up-regulated gene 110 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug110
Target Protein Sequence
MVESSDENDQASSFASTEDLKELRFVFWFSVLIPIFFIALIIIKRYHSCTYQKNRLLRSI FCCMSIDDEEELETDMYDLPIVEPSITLPKYSASLQENERLVGIEGEREGIDVVLNFSKA GEGGVNPYPSFDTPNARILQLRQLAKLKKHGPRISYHGIGIGRCNGNRVLPPYPEPALLP EAPNTREASNNTYLYGFSNNFINISRTLNLRYPSASASISDSLPPPYQVLSVPSVTSTHA FSNNANQT
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Note=Localizes to the barrier septum and cell tip.

Q&A

What is the biological function of mug110 during meiosis?

While mug110 is definitively upregulated during meiosis, surprisingly, deletion strains (mug110Δ) show no obvious meiosis or sporulation defects . Experimental data indicates that mug110 mRNA is a target of multiple RNA-binding proteins including Mei2 and Crp79, suggesting its expression is regulated at the post-transcriptional level during meiosis . The specific molecular function remains under investigation, but current evidence suggests it may be involved in regulatory RNA networks that fine-tune meiotic progression rather than being essential for the process itself.

How is mug110 typically studied in laboratory settings?

Standard approaches for studying mug110 include:

  • Gene deletion studies using homologous recombination techniques

  • Tagging strategies (e.g., TAP-tagging) for protein localization and interaction studies

  • RNA-immunoprecipitation assays to identify associated proteins

  • Transcriptome analysis during meiotic progression

For genetic manipulation, restriction enzymes such as BclI are commonly used for linearizing plasmids containing mug110 sequences . When creating tagged versions, cloning the ORF and UTR directly into vectors such as pFA6a-4x-TAP::NatMX6 allows expression from the endogenous promoter with native regulatory elements .

What methodologies are recommended for studying mug110 RNA-protein interactions?

Several specialized techniques have proven effective for investigating mug110's RNA interactions:

CLIP-Seq (Cross-linking immunoprecipitation followed by sequencing)
This technique has successfully identified mug110 mRNA as a target of Mei2 RNA-binding protein . The methodology involves:

  • UV cross-linking proteins to their bound RNAs in vivo

  • Immunoprecipitation of protein-RNA complexes using specific antibodies

  • RNA extraction, library preparation, and next-generation sequencing

  • Computational analysis to identify binding sites

For example, differential peak calling against untagged CLIP-Seq tags allowed researchers to identify mug110 as one of the top significant targets of Mei2 .

RIP-CHIP (RNA immunoprecipitation followed by microarray analysis)
This technique has been used to complement CLIP-Seq findings and validate RNA-protein interactions:

TechniqueAdvantagesLimitationsApplication to mug110
CLIP-SeqHigh resolution of binding sites, genome-wide coverageTechnically challenging, potential cross-linking biasesIdentified mug110 as a Mei2 target with p = 1.47 × 10^-13
RIP-CHIPLess technically demanding, good for validationLower resolution than CLIP-SeqConfirmed mug110 as target of RNA-binding proteins
RNA decay assaysMeasures post-transcriptional regulationRequires metabolic labelingUseful for determining if mug110 stability is affected by binding proteins

Importantly, these techniques revealed that mug110 mRNA was not enriched in Msa1-TAP CLIP-Seq, suggesting it binds specifically to Mei2 in early meiosis .

How does mug110 deletion affect gene expression networks during meiosis?

When studying transcriptional networks involving mug110, consider these methodological approaches:

  • Transcriptome profiling: Compare wild-type and mug110Δ strains during meiotic time courses to identify differentially expressed genes. Time points should cover the entire meiotic process from induction to sporulation.

  • Double mutant analysis: The creation of double mutants (e.g., mug110Δ mei2Δ) can reveal genetic interactions. Previous research showed that the mug110Δ mei2Δ double mutant was indistinguishable from mei2Δ alone - both failed to initiate meiosis .

  • Integration with other datasets: Cross-reference mug110 expression patterns with other meiotic genes to identify co-regulated networks.

For successful transcriptome profiling, we recommend:

  • Using synchronized cultures (e.g., with nitrogen starvation or temperature-sensitive pat1 mutations)

  • Including multiple biological replicates (minimum three)

  • Collecting samples at 15-30 minute intervals during early meiosis

  • Employing both microarray and RNA-seq methods for validation

What approaches can be used to produce recombinant mug110 protein for biochemical studies?

For recombinant expression of mug110, consider these methodological options:

Expression System Selection:

  • E. coli-based expression: Suitable for high yields but may lack appropriate post-translational modifications.

  • Yeast expression systems: Using S. cerevisiae or native S. pombe for expression with proper folding and modifications.

  • POMBOX toolkit approach: Recently developed molecular cloning toolkit for S. pombe allows modular construction of genetic circuits .

Purification Strategy:
For optimal purification of recombinant mug110, we recommend:

  • Addition of affinity tags (His6, GST, or MBP) at either N- or C-terminus

  • Testing multiple extraction conditions (detergent concentrations if membrane-associated)

  • Multi-step purification process including:

    • Initial affinity chromatography

    • Ion exchange chromatography

    • Size exclusion chromatography

Expression Validation Protocol:

StepMethodExpected Result
Expression confirmationWestern blot with tag-specific antibodiesBand at ~28 kDa (mug110) plus tag size
Solubility assessmentComparing soluble vs insoluble fractionsDistribution between fractions indicates membrane association
Functional validationRNA binding assays using labeled mug110 mRNASpecific binding to candidate proteins

How does mug110 fit into the broader context of meiotic regulation in S. pombe?

Mug110 appears to be part of a complex regulatory network controlling meiotic progression in S. pombe. Current research suggests:

  • Mei2 RNA-binding pathway: Mei2 is required for initiating pre-meiotic DNA synthesis and meiosis in S. pombe . As one of Mei2's RNA targets, mug110 likely plays a role in this critical meiotic regulatory pathway.

  • Integration with Mmi1-mediated regulation: Mei2 sequesters Mmi1, another RNA-binding protein that targets meiosis-specific transcripts for degradation. The interactions between mug110, Mei2, and potentially Mmi1 may contribute to fine-tuning meiotic progression .

  • Relationship to sporulation factors: While mug110Δ shows no obvious sporulation defects, it may function redundantly with other factors in the complex process of spore formation, which involves forespore membrane formation and spore wall assembly .

What are the critical considerations for designing genetic studies involving mug110?

When investigating mug110 function through genetic approaches, researchers should consider:

  • Strain background effects:

    • Use isogenic strains derived from standard S. pombe backgrounds (h⁹⁰, h⁺, h⁻)

    • Common laboratory strains descend from Leupold's original isolates (968 h⁹⁰, 972 h⁻, and 975 h⁺)

  • Meiotic induction methods:

    • Temperature shift with pat1-114 temperature-sensitive mutations

    • Nitrogen starvation in h⁹⁰ (homothallic) strains

    • Mating of h⁺ and h⁻ (heterothallic) strains

  • Phenotypic analysis approaches:

    • Tetrad analysis for assessing sporulation efficiency and spore viability

    • Both random spore and tetrad analyses for studying recombination events

    • Microscopic evaluation of meiotic progression using fluorescent markers

  • Technical validation:

    • Confirm mug110 expression levels during meiosis using RT-qPCR

    • Verify protein expression with western blotting

    • Include appropriate controls for meiotic progression (e.g., known meiotic markers)

What are the emerging techniques that could advance mug110 research?

Recent technological developments offer promising approaches for deeper characterization of mug110:

  • CRISPR-Cas9 genome editing: For precise manipulation of mug110 regulatory sequences or creating specific mutations to study protein domains.

  • Advanced imaging techniques: Live-cell imaging with super-resolution microscopy can track mug110 localization during meiotic progression if tagged with appropriate fluorescent proteins.

  • Proteomics approaches: Proximity labeling methods (BioID, APEX) coupled with mass spectrometry to identify proteins in close proximity to mug110 during different meiotic stages.

  • Single-cell transcriptomics: To examine cell-to-cell variation in mug110 expression during meiotic progression and correlate with other meiotic genes.

  • Structural biology techniques: X-ray crystallography or cryo-electron microscopy to determine the structure of mug110 protein and its interaction with binding partners.

What are common difficulties when working with recombinant mug110 and how can they be addressed?

ChallengePossible CausesRecommended Solutions
Poor expression levelsCodon bias, toxicity to hostOptimize codon usage for expression system; use regulated promoters
Protein insolubilityHydrophobic regions, membrane associationAdd solubilizing tags (MBP, SUMO); optimize buffer conditions with detergents
Degradation during purificationProtease sensitivityInclude protease inhibitors; perform purification at lower temperatures
Non-specific RNA binding in assaysExperimental conditions favor non-specific interactionsIncrease salt concentration; include competitors like heparin or tRNA
Inconsistent meiotic phenotypesStrain background variationsUse multiple independent transformants; maintain strict isogenic backgrounds

How can researchers validate that a phenotype is specifically due to mug110 manipulation?

To ensure phenotypes are specifically attributed to mug110:

  • Complementation testing: Reintroduce wild-type mug110 into knockout strains to rescue phenotypes

  • Multiple allele testing: Create and test different mutant alleles affecting specific domains

  • Controls for off-target effects: When using RNAi or CRISPR, include controls for off-target effects

  • Quantitative phenotype measurement: Use quantitative rather than qualitative assessments of phenotypes

  • Epistasis analysis: Test genetic interactions with known pathway components to position mug110 in relevant pathways

What are the most promising unexplored aspects of mug110 research?

Several research directions warrant further investigation:

  • Structural characterization: Determining the three-dimensional structure of mug110 would provide insights into its molecular function.

  • Interactome mapping: Comprehensive identification of protein and RNA interaction partners during different meiotic stages.

  • Evolutionary conservation: Comparative analysis of mug110 homologs across fungal species to identify conserved functional domains.

  • Regulatory mechanisms: Deeper investigation of transcriptional and post-transcriptional regulation of mug110 during meiosis.

  • Potential redundancy: Identification of functionally redundant factors that might explain the lack of obvious phenotypes in mug110Δ strains.

How might understanding mug110 contribute to broader knowledge of eukaryotic meiosis?

Research on mug110 has potential to advance understanding of:

  • Post-transcriptional regulation during meiosis, which is increasingly recognized as critical in multiple organisms

  • The coordination of meiotic events through RNA-protein interaction networks

  • Evolutionary conservation of meiotic regulatory mechanisms across eukaryotes

  • Principles of gene expression fine-tuning during complex developmental transitions

As a model organism, S. pombe offers significant advantages for studying these processes due to its well-characterized genetic system, relatively simple genome, and amenability to various experimental approaches . Studies of mug110 within this system may reveal conserved principles applicable to meiotic regulation in higher eukaryotes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.