Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 116 protein (mug116)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Meiotically Up-Regulated Gene 116 Protein (mug116)

The Recombinant Schizosaccharomyces pombe Meiotically Up-Regulated Gene 116 Protein (mug116) is a protein expressed in the fission yeast Schizosaccharomyces pombe. This protein is particularly noted for its role during meiosis, a critical phase of sexual reproduction in eukaryotic organisms where genetic material is halved to produce gametes . The recombinant form of this protein is produced in Escherichia coli (E. coli) for research purposes, often with a His-tag for easier purification .

Characteristics of Recombinant mug116 Protein

  • Expression Host: The recombinant mug116 protein is expressed in E. coli, which is a common host for recombinant protein production due to its well-understood genetics and rapid growth rate .

  • Protein Length: The full-length mug116 protein consists of 135 amino acids .

  • Purity and Storage: The protein is available in a lyophilized form with a purity of greater than 90% as determined by SDS-PAGE. It is recommended to store the protein at -20°C or -80°C to maintain its integrity .

  • Reconstitution: For use, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add glycerol for long-term storage .

Research Findings and Applications

CharacteristicsDescription
SpeciesSchizosaccharomyces pombe
Expression HostEscherichia coli
Protein Length135 amino acids
Purity>90% (SDS-PAGE)
Storage-20°C or -80°C
RoleMeiosis

Future Directions

Future research should aim to elucidate the precise mechanisms by which mug116 influences meiotic processes. This could involve genetic studies to identify interacting partners or biochemical assays to determine its enzymatic activities. Additionally, exploring the conservation of mug116-like proteins across different species could provide broader insights into meiotic regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mug116; SPAC5D6.10c; Meiotically up-regulated gene 116 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug116
Target Protein Sequence
MVSRVESVIVFALYKFLQRYFHSFHCFFLLCFTVMLCVVQQCSSAMTSFRCPTFSLSKYT CVLPASIPEMILFTFSSHTFQTPTKKGNKTKKKRKKEKKKETIVEKNKVLKSFALYKKIN NYRSTRCVLVCQCKY
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.