Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 124 protein (mug124)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 124 protein (Mug124) is a protein expressed in Schizosaccharomyces pombe (also known as fission yeast) and is upregulated during meiosis . It is involved in various cellular processes, notably during sexual development, glycogenesis, and in response to glucose limitation .

CategoryDescription
OrganismSchizosaccharomyces pombe
Protein NameMeiotically up-regulated gene 124 protein (Mug124)
RegulationUpregulated during meiosis; regulated by cAMP-dependent protein kinase (Pka1) pathway and glucose limitation
InvolvementSexual development, glycogenesis, response to glucose limitation, methionine salvage pathway
InteractionInteracts with transcription factor Rst2
Homologues/Function partnersMde1 and Mta3 in the methionine salvage pathway

Gene Information

The mug124 gene is found in Schizosaccharomyces pombe .

  • It encodes a protein of 145 amino acids .

Regulation of Mug124 Expression

Mug124 expression is regulated by several factors:

  • cAMP-dependent Protein Kinase (Pka1) Pathway The cAMP/PKA pathway regulates many cellular events in Schizosaccharomyces pombe. Downregulation of this pathway induces the expression of mug14 .

  • Glucose Limitation Limitation of glucose also induces mug14 expression .

  • Transcription Factor Rst2 The regulation of mug14 is dependent on the function of Rst2, a transcription factor that regulates the transition from mitosis to meiosis. The loss of the C2H2-type zinc finger domain in Rst2 abolishes the induction of Mug14 expression. A potential binding site of Rst2 on mug14 is the stress starvation response element of S. pombe (STREP: CCCCTC) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mug124; SPBC19C2.06c; Meiotically up-regulated gene 124 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug124
Target Protein Sequence
MRLQSLSSVAIAETRRQIILTIINSLVYLVNFISCPSIHSIPFHISTHLTSCQANISLLK IVGLHCPFHRRGIASLSVCVALHWIAFSCSVMCHFAWSCALPCFVDSFFPSNFFLRTYAL FTFSLQLWSGNDLQGNHSYLATPTR
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mug124 and what are its key identifiers in scientific databases?

Mug124 (Meiotically up-regulated gene 124 protein) is a 145-amino acid protein expressed in the fission yeast Schizosaccharomyces pombe. It is encoded by the gene designated as SPBC19C2.06c in the S. pombe genome. The protein is identified in UniProt under accession number Q9UUD4 . When discussing this protein in research papers, it is recommended to use both the common name (mug124) and systematic ID (SPBC19C2.06c) in the introduction to avoid confusion, particularly because "mug" genes constitute a family of meiotically up-regulated genes in S. pombe with distinct functions.

How is mug124 expression regulated during the meiotic cycle in S. pombe?

The mug124 gene, as indicated by its name (Meiotically up-regulated gene), shows increased expression during specific phases of meiosis in S. pombe. For quantitative analysis of mug124 expression during meiosis, researchers commonly employ RT-PCR with the primers: Forward 5′-GCGTCGCCTATTGTGCAAGG-3′, Reverse 5′-GTTGGTTGTCGGCAGGTTCG-3′ . To properly analyze mug124 regulation patterns, time-course experiments should be designed with sampling at key meiotic stages (pre-meiotic S phase, meiotic prophase, meiosis I, and meiosis II). Expression data should be normalized against a stable reference gene such as act1, which can be amplified using primers: Forward 5′-ACTATGTATCCCGGTATTGCC-3′, Reverse 5′-GACAGAGTATTTACGCTCAGG-3′ .

What expression systems are optimal for recombinant mug124 production?

E. coli is the primary expression system used for recombinant mug124 production, particularly when fused to an N-terminal His tag for purification purposes . For optimal expression in E. coli, codon optimization may be necessary due to the different codon usage between S. pombe and E. coli. Alternative expression systems worth considering include:

Expression SystemAdvantagesDisadvantagesRecommended For
E. coliHigh yield, rapid growth, simple media requirementsLacks eukaryotic PTMs, inclusion body formationBasic structural studies, antibody production
S. pombeNative PTMs, proper foldingLower yield, more complex cultivationFunctional studies, protein-protein interaction assays
S. cerevisiaeEukaryotic PTMs, well-established protocolsPotential glycosylation differencesComplementation studies
Insect cellsComplex eukaryotic PTMsHigher cost, longer production timeStudies requiring authentic PTMs

For challenging applications requiring native conformation, using S. pombe itself as an expression host may provide advantages despite lower protein yields.

What are the recommended procedures for purification and storage of recombinant mug124?

For His-tagged recombinant mug124 expressed in E. coli, a standard purification protocol involves:

  • Cell lysis using sonication or pressure homogenization in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors

  • Nickel affinity chromatography with step gradient elution (increasing imidazole concentration from 20 mM to 250 mM)

  • Size exclusion chromatography for higher purity requirements

For long-term storage, the purified protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . It is recommended to add glycerol to a final concentration of 50% and aliquot for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to prevent protein degradation. For working stocks, storage at 4°C for up to one week is acceptable .

What reconstitution procedures should be followed for lyophilized mug124?

When working with lyophilized mug124 protein, proper reconstitution is crucial for maintaining activity. The recommended procedure is:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for samples intended for long-term storage

  • Aliquot into small volumes to minimize freeze-thaw cycles

  • Store reconstituted protein at -20°C/-80°C for long-term storage or at 4°C for up to one week

Researchers should verify protein concentration after reconstitution using spectrophotometric methods or protein assays to ensure accurate concentrations for downstream applications.

What techniques are most effective for studying protein-protein interactions involving mug124?

To investigate protein-protein interactions of mug124, researchers should employ multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H): Using mug124 as bait to screen for interacting partners from an S. pombe cDNA library. While useful for initial screening, this method may produce false positives and should be validated with other techniques.

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down recombinant His-tagged mug124 along with its binding partners. This technique requires:

    • Generation of S. pombe lysates under non-denaturing conditions

    • Incubation with purified recombinant mug124

    • Precipitation using anti-His antibodies

    • Analysis of co-precipitated proteins by mass spectrometry

  • Pull-down assays: Using recombinant mug124 as bait protein immobilized on Ni-NTA resin to capture interacting partners from S. pombe lysates.

  • Bioluminescence Resonance Energy Transfer (BRET): For studying protein interactions in living cells, particularly useful for detecting transient or weak interactions.

For any interaction studies, appropriate controls must be included to distinguish specific from non-specific interactions, including the use of unrelated proteins with similar biochemical properties.

How can researchers effectively design knockout or knockdown experiments for mug124?

When designing genetic manipulation experiments for mug124 in S. pombe, researchers should consider several methodological approaches:

  • Gene Deletion: Using homologous recombination to replace the mug124 coding sequence with a selection marker. Design homology arms of at least 500 bp flanking the mug124 gene to ensure efficient targeting.

  • CRISPR-Cas9 System: For targeted disruption of mug124, design guide RNAs targeting the early coding region of the gene. Multiple guide RNAs should be tested for efficiency and specificity.

  • RNA Interference: Although less common in S. pombe due to the lack of some RNAi machinery components, conditional knockdown can be achieved using inducible antisense RNA constructs.

  • Auxin-Inducible Degron (AID) System: For conditional protein depletion, tag mug124 with an AID tag and express the TIR1 F-box protein, allowing auxin-induced protein degradation.

For any genetic manipulation approach, verification of knockout/knockdown efficiency is essential through RT-PCR, Western blotting, or phenotypic analysis. Additionally, complementation experiments should be performed to confirm that observed phenotypes are specifically due to the loss of mug124.

What high-throughput approaches can be used to investigate mug124 function in the broader context of meiosis?

Modern systems biology approaches offer powerful tools for contextualizing mug124 function within meiotic regulation networks:

  • RNA-Seq Analysis: Comparing transcriptome profiles between wild-type and mug124-deleted strains during meiosis to identify differentially expressed genes. This approach requires:

    • Synchronization of meiotic cultures

    • Sample collection at defined time points (pre-meiotic, early meiotic, mid-meiotic, late meiotic)

    • Statistical analysis using packages like DESeq2 or edgeR to identify significant expression changes

  • ChIP-Seq: If mug124 is suspected to have DNA-binding properties or chromatin association, chromatin immunoprecipitation followed by sequencing can map its genomic binding sites.

  • Proteomics Approaches:

    • Quantitative proteomics comparing protein abundance changes in wild-type versus mug124-deleted strains

    • Phosphoproteomics to detect changes in phosphorylation states that might indicate altered signaling pathways

  • Synthetic Genetic Array (SGA) Analysis: Crossing mug124 deletion strain with a collection of S. pombe deletion mutants to identify genetic interactions through fitness measurements.

Data integration from these various approaches can be accomplished using network analysis tools such as Cytoscape, with statistical significance determined through methods appropriate to each data type.

How can structural biology techniques be applied to understand mug124 function?

Determining the three-dimensional structure of mug124 can provide crucial insights into its function. Several approaches are recommended:

  • X-ray Crystallography: Requires:

    • High-purity (>95%) recombinant mug124

    • Screening of crystallization conditions (typically hundreds to thousands of conditions)

    • Optimization of initial crystal hits

    • Data collection at synchrotron radiation facilities

    • Structure determination through molecular replacement or experimental phasing

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Particularly suitable for smaller proteins like mug124 (145 aa), requiring:

    • Expression of isotopically labeled protein (15N, 13C)

    • Collection of multi-dimensional NMR spectra

    • Assignment of resonances to specific residues

    • Structure calculation based on distance constraints

  • Cryo-Electron Microscopy: If mug124 forms part of a larger complex, cryo-EM can visualize its structural context.

  • In Silico Structural Prediction: Modern AI-based tools like AlphaFold2 can provide initial structural hypotheses to guide experimental work.

Structural data should be deposited in the Protein Data Bank (PDB) with proper validation statistics reported, including R-factors, stereochemical quality metrics, and Ramachandran statistics.

How should researchers address solubility issues with recombinant mug124?

Solubility challenges are common when working with recombinant proteins. For mug124, several approaches can be implemented:

  • Optimization of Expression Conditions:

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Vary expression temperature (16°C, 25°C, 30°C)

    • Test different induction conditions (IPTG concentration, induction time)

    • Evaluate the impact of co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Buffer Optimization:

    • Screen various pH conditions (pH 6.0-9.0)

    • Test different salt concentrations (100-500 mM NaCl)

    • Add stabilizing agents (glycerol, trehalose, arginine, glutamic acid)

    • Include reducing agents if the protein contains cysteines (DTT, β-mercaptoethanol)

  • Fusion Tag Strategies:

    Fusion TagBenefits for SolubilityCleavage Options
    MBPHigh solubility enhancementFactor Xa, TEV protease
    SUMOPromotes native foldingSUMO protease
    ThioredoxinEnhances disulfide formationEnterokinase, TEV protease
    GSTGood solubility, affinity purificationThrombin, PreScission protease
  • Refolding Strategies: If inclusion bodies form, develop a refolding protocol:

    • Solubilize inclusion bodies in 8M urea or 6M guanidinium hydrochloride

    • Perform step-wise dialysis to gradually remove denaturant

    • Add oxidizing/reducing agents to facilitate disulfide bond formation/breakage

Researchers should systematically document all conditions tested and their impact on protein solubility and activity to identify optimal production protocols.

What statistical approaches should be used when analyzing mug124 expression data across different experimental conditions?

When analyzing gene expression data for mug124 across various experimental conditions, rigorous statistical approaches should be employed:

  • Normalization Methods:

    • For RT-PCR data: Use the ΔΔCt method with appropriate reference genes (act1 is commonly used in S. pombe)

    • For RNA-Seq data: Apply normalization methods such as RPKM/FPKM, TPM, or use DESeq2's median of ratios method

  • Statistical Tests:

    • For comparing two conditions: Student's t-test (if normally distributed) or Mann-Whitney U test (if non-normally distributed)

    • For comparing multiple conditions: One-way ANOVA followed by post-hoc tests (Tukey's HSD, Bonferroni correction)

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

  • Multiple Testing Correction:

    • Benjamini-Hochberg procedure to control false discovery rate

    • Bonferroni correction for family-wise error rate control

  • Power Analysis:

    • Determine appropriate sample sizes needed to detect relevant effect sizes

    • Typically, a minimum of 3-4 biological replicates is needed, but more may be required depending on variability

  • Data Visualization:

    • Box plots to show distribution of expression values

    • Heat maps for comparing expression across multiple conditions

    • Volcano plots to visualize significance versus fold change

All statistical analyses should be accompanied by clearly stated hypotheses, appropriate effect size calculations, and confidence intervals to facilitate interpretation of biological significance beyond mere statistical significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.