Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 150 protein (mug150)

What is mug150 and what are its basic molecular characteristics?

The mug150 protein is a meiotically up-regulated gene product from Schizosaccharomyces pombe (fission yeast). It is a full-length protein consisting of 104 amino acids with the sequence: MASLFIIMDKRFAVFASSDKPNNCSRKNMFFLKNIIVLSNYLYLLYKAWIVCTTISLCCDFPLFNFLFIAIPYFTEILYNDSSLLWFLFVSLCFITLSFQSLEI. The protein is encoded by the gene mug150, with the ORF name SPCC1322.07c, and has a UniProt accession number of O94546 .

What are the optimal storage conditions for recombinant mug150 protein?

Recombinant mug150 should be stored at -20°C for regular use, while -80°C is recommended for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for stability. It's critical to avoid repeated freeze-thaw cycles, as these can lead to protein degradation and loss of activity. For ongoing experiments, maintaining working aliquots at 4°C for up to one week is advisable to minimize freeze-thaw stress .

How does mug150 relate to other meiotically regulated genes in S. pombe?

While the search results don't specifically address this relationship, understanding the context is important. S. pombe serves as a model organism for studying cellular morphogenesis and cell wall synthesis . Meiotically up-regulated genes like mug150 are typically induced during sexual differentiation and meiosis in fission yeast. These genes often play roles in meiotic chromosome segregation, recombination, or spore formation. To fully characterize mug150's relationship with other meiotically regulated genes, researchers should consider conducting comparative expression analyses during different stages of meiosis.

What are the recommended methods for expressing recombinant mug150 in laboratory settings?

For expressing recombinant mug150, researchers should consider using standard S. pombe expression systems. Based on established protocols for similar S. pombe proteins, expression can be achieved using vectors with appropriate promoters such as the thiamine-repressible nmt1 promoter system, which allows controlled expression . The expression constructs should include the full coding sequence (amino acids 1-104) to ensure complete protein functionality.

For protein purification, techniques similar to those used for Mtf1 purification could be adapted, including:

• Transformation of the expression construct into appropriate S. pombe strains

• Culture in EMM medium with necessary supplements

• Induction by removing thiamine (if using the nmt1 promoter system)

• Cell lysis and protein extraction

• Affinity purification using an appropriate tag system

What culture conditions are optimal for S. pombe strains when studying mug150 expression?

S. pombe strains should be cultured using standard media depending on the experimental requirements:

• For general maintenance: Complete YES medium (0.5% yeast extract, 3% glucose, with adenine, leucine, uracil, histidine, and lysine hydrochloride at 225 mg/L each)

• For selective growth: EMM medium (0.3% potassium hydrogen phthalate, 0.56% sodium phosphate, 0.5% ammonium chloride, 2% glucose, plus vitamins, minerals, and salts) with appropriate auxotrophic supplements (75 mg/L of required nutrients)

• For protein expression studies: Media composition may need to be optimized based on the specific expression system

Temperature should typically be maintained at 30°C for optimal growth, and researchers should consider using Phloxin B (5 mg/L) for monitoring cell viability in certain experiments.

How can ChIP-chip or ChIP-seq approaches be applied to study mug150's potential nuclear functions?

Given that some mitochondrial transcription factors in S. pombe, such as Mtf1, have been found to also localize to the nucleus , it would be reasonable to investigate whether mug150 might have nuclear functions as well. To study such potential functions, researchers can adapt ChIP-chip or ChIP-seq approaches similar to those used for Mtf1:

• Create a strain with a TAP-tagged (or alternative tag) version of mug150 expressed from its endogenous locus

• Perform chromatin immunoprecipitation using the tag to pull down mug150-associated DNA fragments

• For ChIP-chip: Label pulled-down fragments with fluorescent dyes and hybridize to a microarray containing probes for intergenic regions

• For ChIP-seq: Prepare libraries from the pulled-down fragments and perform next-generation sequencing

• Analyze the data to identify genomic regions bound by mug150

Validation of identified targets should be performed using techniques such as PCR amplification of specific regions and functional assays.

What approaches can be used to investigate potential interactions between mug150 and mitochondrial transcription machinery?

To investigate potential interactions between mug150 and mitochondrial transcription machinery, researchers can employ several complementary approaches:

• Co-immunoprecipitation (Co-IP): Using tagged versions of mug150 to pull down associated proteins, followed by mass spectrometry identification or western blotting for known mitochondrial transcription components

• Yeast two-hybrid screening: To identify direct protein-protein interactions with components of the mitochondrial transcription apparatus

• Mitochondrial transcription assays: Comparing mitochondrial gene expression levels in wild-type versus mug150 deletion strains using RT-qPCR or RNA-seq

• Mitochondrial membrane potential analysis: Using fluorescent dyes to detect changes in mitochondrial function when mug150 is deleted or overexpressed, similar to the approaches used for Mtf1

• Subcellular localization studies: Using fluorescent protein fusions (e.g., mug150-GFP) to confirm mitochondrial localization and potential co-localization with known mitochondrial transcription factors

What are the most effective methods for creating mug150 deletion or conditional mutants in S. pombe?

For creating mug150 deletion or conditional mutants in S. pombe, researchers can use standard genetic techniques adapted for this organism:

For deletion mutants:

• PCR-based gene targeting using antibiotic resistance markers (e.g., G418 or hygromycin B) flanked by regions homologous to the sequences upstream and downstream of the mug150 gene

• Transformation of the PCR product into S. pombe cells using lithium acetate method

• Selection on appropriate antibiotic-containing media (e.g., YES plates with 100 mg/L G418 or 150 mg/L hygromycin B)

• Confirmation of deletion by PCR and/or Southern blotting

For conditional mutants:

• Replacing the endogenous promoter with a regulatable promoter such as the nmt1 promoter (repressed by thiamine)

• Creating temperature-sensitive alleles through site-directed mutagenesis

• Using the auxin-inducible degron system for rapid protein depletion

If mug150 proves essential for viability, conditional systems will be particularly important for functional studies.

How can phenotypic analysis be conducted to determine the function of mug150 in S. pombe?

Comprehensive phenotypic analysis of mug150 mutants should include:

• Growth assays: Comparing growth rates of wild-type and mutant strains under various conditions (different media, temperatures, stress conditions)

• Cell morphology analysis: Microscopic examination using differential interference contrast (DIC) and fluorescent staining (e.g., Calcofluor white for cell wall, DAPI for nuclear DNA)

• Cell cycle analysis: Flow cytometry and microscopic examination of synchronized cultures

• Meiosis and sporulation efficiency: Induction of meiosis using SPA medium and quantification of sporulation rates and spore viability

• Gene expression profiling: RNA-seq or microarray analysis to identify genes affected by mug150 deletion

• Mitochondrial function assays: Analysis of mitochondrial membrane potential, oxygen consumption rates, and mitochondrial morphology

When conducting these analyses, it's crucial to include appropriate controls and to verify the specificity of observed phenotypes through complementation tests.

What are the most common challenges in interpreting mug150 expression data during meiosis?

Interpreting mug150 expression data during meiosis presents several challenges:

• Temporal complexity: Meiosis involves multiple sequential stages with distinct gene expression patterns. Properly synchronizing cultures and sampling at appropriate timepoints is essential for accurate interpretation.

• Cell heterogeneity: Not all cells in a culture enter meiosis simultaneously, potentially masking expression changes. Single-cell approaches may be needed for precise analysis.

• Functional redundancy: Other genes may compensate for mug150 deletion, obscuring phenotypes. Researchers should consider creating double or triple mutants with functionally related genes.

• Post-transcriptional regulation: Changes in mRNA levels may not directly correlate with protein abundance or activity. Complementary protein-level analyses should be conducted.

• Strain background effects: Different laboratory strains may show variability in mug150 expression or phenotypes. Using multiple strain backgrounds can help establish the generality of findings.

To address these challenges, researchers should employ time-course analyses with multiple biological replicates and use complementary approaches at both RNA and protein levels.

How should conflicting results between protein localization and functional studies of mug150 be resolved?

When faced with conflicting results between protein localization and functional studies of mug150, researchers should systematically address the discrepancy through multiple approaches:

• Validate protein localization using multiple methods:

  • Fluorescent protein tagging at both N- and C-termini to ensure tag position isn't affecting localization

  • Immunofluorescence with specific antibodies

  • Subcellular fractionation followed by western blotting

  • Super-resolution microscopy for more precise localization

• Consider dynamic localization:

  • Perform time-course studies to determine if localization changes during cell cycle or in response to conditions

  • Live-cell imaging to capture real-time localization changes

• Examine tag interference:

  • Create different tag sizes and types to check if the tag itself is affecting localization

  • Complement with untagged protein for functional assays

• Isolate specific functions:

  • Create domain-specific mutations to separate different functional domains

  • Use targeted localization signals to force protein to specific compartments and assess function

As seen with the transcription factor Mtf1 in S. pombe, which unexpectedly showed both mitochondrial and nuclear localization , proteins may have dual localization and functions. These apparent conflicts may actually reveal important biological insights about multifunctional proteins.

What S. pombe strain collections and genetic resources are most valuable for mug150 research?

Researchers studying mug150 should consider utilizing these key resources:

• S. pombe strain collections:

  • Bioneer deletion mutant collection (contains systematic gene deletions)

  • Japanese National BioResource Project (NBRP) S. pombe strain collection

  • Strain 972 / ATCC 24843 (standard laboratory wild-type strain)

• Plasmid resources:

  • pREP vectors with various strength nmt1 promoters for controlled expression

  • Vectors for fluorescent protein tagging (similar to pREP3-Mtf1GFP mentioned in search results)

  • Integrative plasmids for chromosomal modifications

• Genomic resources:

  • PomBase database (comprehensive resource for S. pombe genomic and proteomic data)

  • Genome-wide microarray platforms for expression and ChIP-chip studies

• Community resources:

  • S. pombe research community forums and mailing lists for protocol sharing

  • Established S. pombe laboratories for specialized techniques

When working with these resources, researchers should follow standard protocols for S. pombe culture and genetic manipulation to ensure reproducibility across different laboratories.

How can standardized protocols for mug150 research facilitate multi-laboratory collaborations?

Standardizing protocols for mug150 research can significantly enhance multi-laboratory collaborations through:

• Reproducibility improvements:

  • Consistent media compositions (YES, EMM, YPD as described in search results)

  • Standardized growth conditions (temperature, aeration, cell density measurements)

  • Uniform genetic manipulation techniques (transformation, selection methods)

• Materials standardization:

  • Consistent storage conditions for recombinant proteins (-20°C for regular storage, -80°C for long-term)

  • Standardized buffer compositions for protein extraction and analysis

  • Agreed-upon antibody specifications and validation criteria

• Data sharing frameworks:

  • Common data formats for expression analyses

  • Standardized metadata reporting for experimental conditions

  • Centralized repositories for raw data and analyzed results

• Quality control measures:

  • Shared positive and negative controls for key experiments

  • Interlaboratory validation studies for critical findings

  • Regular proficiency testing for specialized techniques

Laboratories should establish these standards early in collaborative projects and document all protocols in sufficient detail to allow for precise replication across different research environments.