Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 154 protein (mug154)

Shipped with Ice Packs
In Stock
Cat. No.
BT2068889
Source
in vitro E.coli expression system
Synonyms
mug154; SPCC4G3.11; Meiotically up-regulated gene 154 protein
Quick Inquiry

Description

Domain Architecture

  • Transmembrane Regions: Computational models suggest multiple transmembrane helices, consistent with ER membrane localization .

  • Conserved Motifs: Contains a Pfam domain (PF10332) linked to fungal-specific functions .

Secondary Structure

  • Enriched in α-helices and β-sheets, typical for membrane-associated proteins .

Functional Insights

Mug154 is upregulated during meiosis and implicated in:

Biological Roles

  • Meiotic Regulation: Essential for proper meiotic progression, though exact mechanisms remain under investigation .

  • Membrane Trafficking: Associated with ER membrane dynamics (GO:0005789) .

Gene Ontology (GO) Annotations

CategoryTerms
Cellular ComponentEndoplasmic reticulum membrane (GO:0005789)
Biological ProcessMeiosis (GO:0007096); cellular protein modification (GO:0030702)
Molecular FunctionProtein binding (GO:0099114)

Research Applications

Mug154 is primarily used in in vitro studies due to its high purity and specificity:

  • SDS-PAGE Analysis: Serves as a reference protein for electrophoretic mobility studies .

  • Meiosis Studies: Investigated for its role in fungal sporulation and chromosome segregation .

  • Protein Interaction Mapping: Used in yeast two-hybrid screens to identify binding partners .

Production and Quality Control

  • Expression System: E. coli (BL21 or similar strains) .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  • Endotoxin Levels: Available in low-endotoxin formats upon request .

Limitations and Future Directions

  • Functional Data Gaps: Detailed mechanistic insights into Mug154’s role in meiosis are lacking .

  • Interaction Networks: Limited empirical data on binding partners or pathway associations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your desired format when placing the order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage condition, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mug154; SPCC4G3.11; Meiotically up-regulated gene 154 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug154
Target Protein Sequence
MGKLIRRTSLTSKIINLPIDYFIYVCEQFDSVEWDKVSDRYSIPFSLAVNFIFLLMRIYI KSTHVPVQRNQLFVDKQSINTSRSWFRAFLSFLSICFLFISFLNFIFSTRFQNKLYRTLP QDKRTTTSTPNVKPVFQHSNNDDGDEQVFELKVWSPNQFLLNFACLFSPAHALILWFYST SLRVTLLTFLLSFTTLHFVNKFSLLLKDQQYLHRQVFFEYDKKFVEPRLSVVKRDVAINT TRGPTTASIEYFTPRKPIDTFLEHRSSSHDHLTSTPRTPIALQRRSVHHLHDSGISRDSS SPFKRFPHLSDGSSRF
Uniprot No.
P87236

Target Background

Function
Plays a role in meiosis.
Database Links

KEGG: spo:SPCC4G3.11

STRING: 4896.SPCC4G3.11.1

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.