Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 162 protein (mug162)

Shipped with Ice Packs
In Stock

Description

Biological Context and Function

mug162 is a meiosis-specific protein upregulated during sporulation in S. pombe. While its exact functional role remains under investigation, homologs in the mug gene family (e.g., mug28) are implicated in:

  • Spore wall maturation: Ensuring proper forespore membrane (FSM) formation .

  • Transcriptional regulation: Coordinating meiotic gene expression .

Comparative Analysis of mug Family Proteins

ProteinFunctionPhenotype of Knockout
mug162Unknown; likely regulates meiosisNot yet characterized
mug28FSM formation, RNA bindingAberrant spore viability
rec16Meiotic replication, recombinationDelayed DNA synthesis, reduced transcripts

Applications in Research

Recombinant mug162 is primarily used for:

  1. Functional studies: Investigating its role in meiotic regulation via knockout/overexpression experiments.

  2. Protein interaction assays: Identifying binding partners using pull-down or yeast two-hybrid systems .

  3. Antibody production: Serving as an antigen for polyclonal/monoclonal antibody development .

Product Comparison

VendorProduct CodeFormatTagPrice Range (USD)
Creative BioMartRFL4856SFLyophilizedHis-tag$400–$600
CusabioCSB-EP891642SXV1-BLiquid/LyophilizedHis-tag$350–$550

Reconstitution guidance:

  • Lyophilized protein should be dissolved in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

Research Gaps and Future Directions

  • Functional characterization: No direct studies on mug162’s role in meiosis or DNA repair are documented.

  • Pathway involvement: While mug162 is annotated as meiosis-specific, its participation in conserved pathways (e.g., complement system, immune activation) remains unexplored .

  • Structural studies: High-resolution crystallography or cryo-EM could elucidate its RNA-binding motifs or enzymatic domains .

References to Key Studies

  1. Rec16 in S. pombe: Highlights coupling of replication and recombination defects .

  2. FHR4 in AMD: Demonstrates immune system protein regulation as a model for mug162 functional studies .

  3. Meiotic drivers (wtf genes): Provides context on transcriptional regulation mechanisms relevant to mug162 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
mug162; SPAC11H11.02c; Meiotically up-regulated gene 162 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug162
Target Protein Sequence
MDDEVYKQRLTALNNLRIVIFFDILIILLGYIGTWNLKTLQLVNPSLWSFSPSLWIYIRG TVLCADCIFTAGSANEYSAVQNSVFQVSSLMFYGLMMEFFGYSFDRVGCMELAFISFSAA CYFNIRSIKSLSLKNKNWTIISIIEIPIKLHFILNVLLFLKFSEYMLPLLGRVHLSYHLF ALWVINLYIWIKLIDSKDFVLGFLAGLSVLLLNTGSLITAKPLISYFNLLTSCLIIFPSI WIYAIEKKNFKNLSYEDDDYRNYW
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is mug162 and what is its significance in S. pombe research?

Mug162 (Meiotically Up-Regulated Gene 162 protein) is a 264-amino acid protein encoded by the SPAC11H11.02c gene in the fission yeast Schizosaccharomyces pombe . As indicated by its name, mug162 exhibits increased expression during meiotic processes, suggesting a potential role in sexual reproduction or spore formation in this organism .

The protein has gained significance in research contexts due to its potential involvement in mating-type switching mechanisms, which are sophisticated gene conversion events regulated by DNA replication, heterochromatin formation, and chromodomain proteins like Swi6 . Understanding mug162 contributes to broader insights into regulated gene expression during meiosis and may provide parallels to similar processes in higher eukaryotes.

How is recombinant mug162 typically produced for research applications?

For research applications, recombinant mug162 is typically produced as a full-length protein (amino acids 1-264) with an N-terminal histidine tag in E. coli expression systems . The standard production process involves:

  • Cloning the mug162 coding sequence into an appropriate expression vector with a His-tag coding sequence

  • Transformation into E. coli expression hosts

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification via nickel affinity chromatography

  • Final preparation as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE

This recombinant approach allows researchers to obtain significant quantities of the protein for various biochemical and functional studies, including interaction analysis, structural determinations, and in vitro functional assays.

What are the optimal storage and handling conditions for recombinant mug162?

Proper storage and handling of recombinant mug162 is critical for maintaining its structural integrity and biological activity. Based on established protocols, the following guidelines should be observed:

ParameterRecommendationRationale
Long-term storage−20°C/−80°CPrevents protein degradation
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Stabilizes protein structure
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization
Working concentrationAdd 5-50% glycerol (final concentration)Prevents freeze-thaw damage
Working aliquot storage4°C for up to one weekMinimizes degradation
Freeze-thaw cyclesAvoid repeated cyclesPrevents denaturation

Before opening a vial containing lyophilized mug162, it should be briefly centrifuged to ensure all material is at the bottom of the container. After reconstitution, the addition of glycerol (preferably to a final concentration of 50%) and division into single-use aliquots is strongly recommended to prevent protein degradation through repeated freeze-thaw cycles .

What experimental design considerations are essential when studying mug162 function?

When designing experiments to investigate mug162 function, researchers should implement the following statistical and methodological principles:

  • Replication: Include biological replicates (different protein preparations) and technical replicates (repeated measurements) to ensure reproducibility and estimate experimental variance .

  • Randomization: Randomize the order of experimental conditions and sample processing to minimize systematic errors and bias in the results .

  • Blocking or grouping: Group experimental units into homogeneous blocks based on potential confounding variables (e.g., protein batch, time of experiment) to reduce unwanted variability .

  • Multifactorial design: Consider multiple factors simultaneously (e.g., temperature, pH, presence of interaction partners) to identify interaction effects that might not be apparent in single-factor experiments .

  • Sequential approach: Implement a step-wise experimental strategy, beginning with pilot studies to estimate variance and effect sizes before conducting full-scale experiments .

  • Controls: Include appropriate positive and negative controls, including wild-type protein comparisons and inactive mutants when available .

How can researchers determine appropriate sample sizes for mug162 functional studies?

Determining appropriate sample sizes through power analysis is crucial for detecting meaningful effects in mug162 studies. The sample size required depends on several factors:

  • Effect size: The magnitude of the biological effect you expect to detect. Larger effects require smaller sample sizes, while subtle effects require larger samples .

  • Statistical power: Typically set at 0.8 (80% probability) of detecting an effect if it exists. Higher power requires larger sample sizes .

  • Significance level (α): Commonly set at 0.05. More stringent significance levels (smaller α) require larger sample sizes .

  • Variability: Higher variability in measurements requires larger sample sizes .

For typical protein-protein interaction studies with mug162, researchers should consider:

Experimental DesignEffect SizePowerAlphaSample Size Estimate
Simple comparison (two groups)Large (d=0.8)0.80.0526 (13 per group)
Simple comparison (two groups)Medium (d=0.5)0.80.0564 (32 per group)
Simple comparison (two groups)Small (d=0.2)0.80.05394 (197 per group)
Multiple groups (ANOVA, 4 groups)Large (f=0.4)0.80.0576 (19 per group)
Repeated measures (within-subject)Medium (f=0.25)0.80.0524 total measurements

Two-sided tests without preference for direction of effect require larger sample sizes than one-sided tests . Researchers should also be aware that non-Gaussian distributions may require alternative approaches to sample size calculation.

What is the potential role of mug162 in meiotic processes in S. pombe?

As a meiotically up-regulated gene, mug162 expression increases specifically during sexual reproduction in S. pombe, suggesting specialized functions during this process . While the precise role remains under investigation, several lines of evidence point to potential functions:

  • Mating-type switching involvement: Research indicates mug162 may participate in the complex processes of mating-type switching, which involves programmed gene conversion events regulated by DNA replication and heterochromatin formation .

  • Membrane-associated functions: The protein's predicted transmembrane domains suggest it may function in membrane reorganization events that occur during meiosis, potentially in nuclear membrane modifications during meiotic divisions .

  • Signaling pathway integration: The C-terminal acidic region may serve as an interaction surface for other meiotic proteins, potentially integrating mug162 into signaling cascades that regulate meiotic progression .

  • Gene expression regulation: Given the connection to heterochromatin-related processes, mug162 might participate in the substantial changes in gene expression that characterize the transition from mitotic to meiotic cell cycles .

Researchers investigating these hypotheses should consider designing experiments that specifically examine protein localization during different meiotic stages and identify potential interaction partners through techniques such as co-immunoprecipitation or yeast two-hybrid screening.

How can the relationship between mug162 and chromatin regulation be experimentally investigated?

The potential involvement of mug162 in processes related to heterochromatin and mating-type switching suggests connections to chromatin regulation . To investigate these relationships experimentally, researchers should consider:

  • Chromatin immunoprecipitation (ChIP): Using antibodies against recombinant mug162 or epitope-tagged versions to identify genomic regions where the protein might associate with DNA, focusing particularly on mating-type loci and regions with heterochromatic characteristics.

  • Genetic interaction screens: Systematic analysis of double mutants combining mug162 deletion with mutations in known chromatin regulators, particularly focusing on the histone H3 lysine 4 (H3K4) methyltransferase complex (Set1, Swd1, Swd2, Swd3, Spf1, Ash2) and the BRE1-like ubiquitin ligase Brl2, which have been implicated in related processes .

  • Localization studies: Fluorescence microscopy with tagged mug162 to determine if the protein colocalizes with heterochromatin markers, particularly during meiosis and mating-type switching events.

  • Biochemical assays: In vitro assays to test whether mug162 directly interacts with chromatin components, including histones, histone-modifying enzymes, or heterochromatin proteins like Swi6.

  • Transcriptome analysis: RNA-seq comparisons between wild-type and mug162 mutant cells, particularly during meiosis, to identify genes whose expression depends on mug162 function.

These approaches would help establish whether mug162 has direct or indirect roles in chromatin-based processes during meiosis and mating-type determination.

What experimental approaches can address contradictory data in mug162 functional studies?

When researchers encounter contradictory data regarding mug162 function, systematic troubleshooting and validation approaches should be employed:

  • Reproducibility assessment: First determine whether contradictions arise from technical variability or represent genuine biological complexity. Increase technical and biological replicates to establish the consistency of observations .

  • Methodological validation: Employ multiple independent techniques to investigate the same question. For example, if protein-protein interactions show discrepancies, validate using both co-immunoprecipitation and proximity ligation assays.

  • Strain and construct verification: Confirm the genetic background of S. pombe strains and the sequence integrity of expression constructs, as unintended mutations can cause phenotypic variations.

  • Condition-dependent effects: Systematically vary experimental conditions (temperature, nutrient status, cell cycle stage) to determine if contradictory results reflect condition-dependent functions of mug162.

  • Quantitative approach: Move from qualitative to quantitative measurements with appropriate statistical analysis to determine if apparent contradictions reflect threshold effects rather than binary outcomes .

  • Alternative splice variants or modifications: Investigate whether mug162 exists in multiple forms due to alternative splicing or post-translational modifications that could exhibit different or even opposing functions.

By approaching contradictions as opportunities for deeper investigation rather than obstacles, researchers can often uncover complex regulatory mechanisms and context-dependent functions of proteins like mug162.

How should researchers integrate mug162 findings into broader understanding of meiotic regulation?

To effectively integrate findings about mug162 into the broader understanding of meiotic regulation, researchers should:

  • Pathway mapping: Position mug162 within known meiotic regulatory networks by identifying genetic and physical interactions with established meiotic regulators, particularly focusing on connections to heterochromatin formation and mating-type switching machinery .

  • Comparative analysis: Compare mug162 functions with homologous proteins in other organisms to identify evolutionarily conserved mechanisms versus species-specific adaptations in meiotic regulation.

  • Multi-omics integration: Combine proteomics, transcriptomics, and epigenomics data to create comprehensive models of mug162's roles across different meiotic stages and cellular contexts.

  • Temporal resolution: Establish precise timing of mug162 activity during meiotic progression through time-course experiments, determining whether it functions in initiation, progression, or completion of specific meiotic events.

  • Structural biology integration: Connect structural features of mug162 to its functional roles, particularly focusing on how transmembrane domains might position the protein to coordinate between membrane dynamics and nuclear events during meiosis.

  • Systems biology modeling: Develop mathematical models that incorporate mug162 into regulatory networks, generating testable predictions about system-level effects of mug162 perturbation.

This integrative approach avoids viewing mug162 in isolation and instead contextualizes findings within the complex, orchestrated process of meiotic regulation.

What statistical approaches are most appropriate for analyzing mug162 expression data?

When analyzing mug162 expression data, researchers should select statistical approaches based on experimental design and data characteristics:

  • For comparing expression levels between two conditions (e.g., meiotic vs. mitotic cells):

    • Student's t-test for normally distributed data with equal variances

    • Welch's t-test for normally distributed data with unequal variances

    • Mann-Whitney U test for non-normally distributed data

  • For comparing expression across multiple conditions (e.g., time course during meiosis):

    • One-way ANOVA followed by post-hoc tests (e.g., Tukey's HSD) for normally distributed data

    • Kruskal-Wallis test followed by Dunn's test for non-normally distributed data

  • For repeated measures designs (e.g., same cultures measured at different timepoints):

    • Repeated measures ANOVA for normally distributed data

    • Friedman test for non-normally distributed data

  • For correlation analyses (e.g., correlating mug162 expression with other meiotic genes):

    • Pearson correlation for linear relationships between normally distributed variables

    • Spearman correlation for monotonic relationships or non-normally distributed variables

  • For multivariate analyses (e.g., expression patterns across multiple genes including mug162):

    • Principal Component Analysis (PCA) or clustering methods to identify co-regulated gene groups

    • Multiple regression to identify predictors of mug162 expression

Regardless of the specific test, researchers should always:

  • Check assumptions (normality, homogeneity of variance) before applying parametric tests

  • Apply appropriate corrections for multiple testing (e.g., Bonferroni, Benjamini-Hochberg)

  • Report effect sizes alongside p-values to indicate biological significance

How can researchers overcome challenges in developing antibodies against mug162?

Developing specific antibodies against mug162 presents several challenges, including its predicted membrane-associated nature and potential low immunogenicity of certain regions. Researchers can employ the following strategies to overcome these challenges:

  • Epitope selection: Use bioinformatic tools to identify immunogenic regions of mug162 that are likely exposed (not embedded in membranes) and show low sequence similarity to other proteins. The C-terminal region (LSYEDDDYRNYW) contains charged residues that may serve as a good epitope target .

  • Synthetic peptide approach: Rather than using the full protein, design synthetic peptides corresponding to predicted antigenic regions for immunization. This approach can increase specificity and avoid problems with protein solubility.

  • Recombinant fragment strategy: Express soluble fragments of mug162 (avoiding transmembrane regions) as immunogens rather than the complete protein.

  • Alternative species immunization: If conventional rabbit or mouse antibodies yield poor results, consider alternative species such as chicken, which might recognize different epitopes due to evolutionary distance.

  • Monoclonal development: Develop monoclonal antibodies rather than polyclonal preparations to increase specificity, using hybridoma screening with multiple validation methods to select the most specific clones.

  • Validation strategy: Implement rigorous validation using:

    • Western blotting against recombinant protein and endogenous mug162

    • Immunoprecipitation followed by mass spectrometry

    • Parallel testing in wild-type and mug162-deletion strains

    • Peptide competition assays to confirm specificity

  • Alternative detection approaches: Consider epitope tagging of genomic mug162 (HA, FLAG, etc.) which allows the use of well-characterized commercial antibodies against the tag rather than the protein itself.

These strategies can help overcome the inherent difficulties in generating specific antibodies against challenging targets like membrane-associated or low-abundance proteins.

What are the most promising future research directions for understanding mug162 function?

Based on current knowledge, several promising research directions could significantly advance understanding of mug162 function:

  • High-resolution localization studies: Employing super-resolution microscopy techniques to precisely determine the subcellular localization of mug162 during different stages of meiosis and in response to various cellular stresses.

  • Interaction network mapping: Comprehensive identification of mug162 protein interaction partners through techniques such as BioID, proximity labeling, or cross-linking mass spectrometry, particularly focusing on potential connections to heterochromatin components .

  • Structural biology approaches: Determining the three-dimensional structure of mug162 through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to gain insights into functional domains and interaction surfaces.

  • In vivo functional dissection: Creating a series of targeted mutations in mug162 to disrupt specific domains or modification sites, followed by phenotypic analysis to connect structural features to biological functions.

  • Systems-level analysis: Integrating transcriptomic, proteomic, and genetic interaction data to position mug162 within the broader meiotic regulatory network and identify potential redundant or compensatory pathways.

  • Evolutionary comparative studies: Analyzing mug162 homologs across diverse fungal species to identify conserved functional domains and species-specific adaptations, providing insights into core functions versus specialized roles.

These research directions, pursued in parallel, would provide complementary insights into the biological roles of mug162 and its contribution to the complex process of meiosis in S. pombe.

How can knowledge of mug162 contribute to broader understanding of eukaryotic meiosis?

Understanding mug162 function has potential to contribute to broader knowledge of eukaryotic meiosis in several ways:

  • Model system insights: S. pombe is a powerful model organism for studying meiosis, with many core processes conserved across eukaryotes. Discoveries about mug162 may reveal mechanisms relevant to higher organisms, including humans .

  • Specialized adaptor functions: If mug162 serves as an adaptor between membrane dynamics and chromatin processes during meiosis, this could reveal general principles about how cells coordinate different cellular compartments during complex developmental processes.

  • Regulatory network principles: Defining how mug162 is regulated and how it affects downstream targets can illuminate general principles of regulatory networks that govern developmental transitions in eukaryotes.

  • Evolution of meiotic processes: Comparative studies of mug162 across fungal species could provide insights into how meiotic processes evolve and adapt to different ecological niches and reproductive strategies.

  • Methodology development: Technical approaches developed to study challenging aspects of mug162 biology could be applied to other difficult-to-study meiotic proteins across model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.