Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 70 protein (mug70)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Meiotically Up-Regulated Gene 70 Protein (Mug70) is a protein that is up-regulated during meiosis in the fission yeast Schizosaccharomyces pombe . Mug70 is conserved in both fungi and plants and implicated in signaling . It contains both a CBS (cystathionine-beta-synthase) domain and a PB1 (Phox and Bem1) domain .

  • Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

  • Gene Name: mug70

  • ORF Name: SPAC24C9.05c

  • UniProt Accession Number: O13965

Protein Structure and Domains

Mug70 contains a PB1 domain, which ranges from 80 to 100 amino acids in length and exhibits a Ubiquitin-like β-grasp fold with five β-sheets and two α-helices . The β-grasp fold is widespread in nature and is present in more than 60 distinct protein families across eukaryotes . PB1 domains are known to mediate protein-protein interactions that are important for innate immunity and cell polarity .

The PB1 domain can be divided into three types based on the presence or absence of conserved motifs. Type-1 PB1 domains contain only the conserved OPCA motif, type-2 PB1 domains contain only a conserved lysine (K) residue in β1, and type-1/2 PB1 domains contain both the lysine and the OPCA motifs .

Expression and Purification

Recombinant Mug70 is produced in a heterologous expression system and purified to homogeneity .

  • Expression Region: Full length protein (1-730)

  • Tag Info: The tag type is determined during the production process .

  • Purity: Typically >90% as determined by SDS-PAGE .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .

Function

Mug70 is known to have a role in meiosis . A study found that Mug70 binds a DNA-binding domain construct with, gpc1, glycerophosphocholine acyltransferase (GPCAT) Gpc1 .

Sequence Information

The amino acid sequence of Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 70 protein(mug70) is :

MTVGTLSVVSSTASDTASHVSDTRKRQYQRDEALRKKIISELGKKSGNFESPVRKIRRNG

EPGTVDSAALDPALTVHMQSLVTETAQLMAAKRQNCVLVVDDDEQLAGIVTATDIATRCV

GAGLNARQTLIADIMSTSPLCITSDTRFDDALLLMIEHKFRHLPVVSDGGPDGSAGDEGD... VIGIINMRACLREPLNRIARQQEAAQKLVEALEGAQEEIENKSVSGNTNSSSVSGNHAAE

FLEYVESLKKKASGLEIMSLIDSSEEPFLVGTRTTVAEATESMARSGVSAVLVMDNGAVS

GVFTAHDVVLRVLAAGLDPYRSSVIRVMTPHPDCALASLRVSTALERMIEGKFSNLPVVD

ESDAIIGMLSLFHLATAIEQTPEEEEEVFDQAENDAGIEPSNGFEDQQQQLLGNSNEVVE

NYDVNPPLPLNPLPSNTQQSESTYEYSARQLPKPPVQAWQNENLSSNNKPQEYVGVENDY

NFSNNPPTAMSEQSFHPSVSQKPMDTPENGSNSFAASPYLQPYNSASQLAPSYVGSLPQY

HGNPSFVEQALQDLVQPTDSASQIFPLNPQSPSQFTIKYRSIAGRVHRLRLDGINSVSDL

RTAVEEREKEQLVTLTYIDDEGDVVELVSDSDLREAILLARRRGLPRLEVRGVAAFTNHL... ESSHPPISTVDSSIGSASVVEKGVANSIVDIHQPTAKADKGNSKKPIYIGIVSSSIVILA

VSMWYLRRKR

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
mug70; SPAC24C9.05c; Meiotically up-regulated gene 70 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-730
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug70
Target Protein Sequence
MTVGTLSVVSSTASDTASHVSDTRKRQYQRDEALRKKIISELGKKSGNFESPVRKIRRNG EPGTVDSAALDPALTVHMQSLVTETAQLMAAKRQNCVLVVDDDEQLAGIVTATDIATRCV GAGLNARQTLIADIMSTSPLCITSDTRFDDALLLMIEHKFRHLPVVSDGGPDGSAGDEGD VIGIINMRACLREPLNRIARQQEAAQKLVEALEGAQEEIENKSVSGNTNSSSVSGNHAAE FLEYVESLKKKASGLEIMSLIDSSEEPFLVGTRTTVAEATESMARSGVSAVLVMDNGAVS GVFTAHDVVLRVLAAGLDPYRSSVIRVMTPHPDCALASLRVSTALERMIEGKFSNLPVVD ESDAIIGMLSLFHLATAIEQTPEEEEEVFDQAENDAGIEPSNGFEDQQQQLLGNSNEVVE NYDVNPPLPLNPLPSNTQQSESTYEYSARQLPKPPVQAWQNENLSSNNKPQEYVGVENDY NFSNNPPTAMSEQSFHPSVSQKPMDTPENGSNSFAASPYLQPYNSASQLAPSYVGSLPQY HGNPSFVEQALQDLVQPTDSASQIFPLNPQSPSQFTIKYRSIAGRVHRLRLDGINSVSDL RTAVEEREKEQLVTLTYIDDEGDVVELVSDSDLREAILLARRRGLPRLEVRGVAAFTNHL ESSHPPISTVDSSIGSASVVEKGVANSIVDIHQPTAKADKGNSKKPIYIGIVSSSIVILA VSMWYLRRKR
Uniprot No.

Target Background

Function

Plays a role in meiosis.

Database Links
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is mug70 and what organism does it come from?

Mug70 (Meiotically up-regulated gene 70 protein) is a protein encoded by the mug70 gene (also known as SPAC24C9.05c) in Schizosaccharomyces pombe, commonly known as fission yeast . This protein is specifically upregulated during meiosis, suggesting its important role in sexual reproduction in this organism . S. pombe is a unicellular eukaryote that serves as an excellent model organism for studying fundamental cellular processes due to its similarity to higher eukaryotes in numerous molecular mechanisms, including cell cycle regulation, chromosome structure, and meiosis .

What are the key characteristics of the mug70 protein?

Mug70 protein has several notable characteristics:

  • UniProt accession: O13965 / MUG70_SCHPO

  • Gene name: mug70 (ORF Name: SPAC24C9.05c)

  • Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • PRO ID: PR:O13965

  • Function: The protein is upregulated during meiosis, suggesting a role in sexual reproduction

  • Post-translational modifications: Extensive phosphorylation at multiple sites (see Table 1)

Table 1: Phosphorylation Sites Identified in mug70 Protein

SitePTM TypeSourceReferenced in PMIDs
T2PhosphorylationPomBase30726745
T5PhosphorylationPomBase30726745
S10PhosphorylationPomBase29996109
T12PhosphorylationPomBase29996109
S14PhosphorylationPomBase21712547, 30726745, 29996109
S51PhosphorylationPomBase24763107, 33823663, 29996109, 30726745, 21712547, 25720772
S223PhosphorylationPomBase30726745, 21712547, 33823663
S687PhosphorylationPomBase21712547, 24763107, 29996109, 25720772, 30726745

How does S. pombe serve as a model organism for studying human diseases?

Schizosaccharomyces pombe has been described as a "micro-mammalian" model organism due to its remarkable similarities with metazoan species, making it valuable for understanding human disease mechanisms . These similarities include:

  • Chromosomal structure and complexity similar to higher eukaryotes

  • Relatively large chromosomes and centromeres

  • Low-complexity replication origins

  • Epigenetic mechanisms for regulation of gene expression and centromere maintenance

  • G2/M control of cell cycle, similar to human cells

  • DNA repair and recombination mechanisms comparable to humans

  • Spliceosome components with functional alternative splicing

  • RNA interference (RNAi) machinery

  • Post-translational modification systems that mirror many human processes

These features make proteins like mug70 and the cellular processes they participate in relevant to understanding fundamental mechanisms that may be conserved in human cells.

What is the phosphorylation profile of mug70 and how might it relate to protein function?

Mug70 undergoes extensive phosphorylation at multiple sites, with at least 21 documented phosphorylation sites . The protein shows clusters of phosphorylation, particularly at the N-terminus (T2, T5, S10, T12, S14, T16, S18, S21) and in the region from S223-S234 . The extensive phosphorylation of mug70 suggests regulation by kinase cascades, potentially involved in meiotic progression.

These phosphorylation events may facilitate several functions:

  • Temporal regulation of protein activity during meiotic progression

  • Protein-protein interactions with meiotic apparatus components

  • Subcellular localization changes in response to meiotic progression

  • Structural modifications affecting protein function

While the specific kinases responsible for mug70 phosphorylation remain unidentified, the clustered nature of phosphorylation sites suggests potential regulation through mechanisms similar to those observed in other meiotic proteins such as Mug27, which is a meiosis-specific protein kinase involved in spore formation .

How does mug70 compare to other meiotically upregulated genes in S. pombe?

Although the search results don't provide direct comparisons between mug70 and other meiotically upregulated genes, we can draw some insights by comparing with the better-characterized Mug27 (also known as Ppk35) :

  • Temporal expression: Like mug70, Mug27 is specifically expressed during meiosis, with transcription beginning after horsetail movement and continuing through the second meiotic division .

  • Function: Mug27 is a protein kinase essential for proper spore formation. When deleted (mug27Δ), cells produce smaller spores with reduced viability . The function of mug70 is less well-characterized, but its meiotic upregulation suggests a role in spore development or meiotic progression.

  • Localization: Mug27 localizes to the spindle pole body (SPB) in early meiosis and later translocates to the forespore membrane (FSM) at late anaphase II . The localization pattern of mug70 is not specified in the search results, representing a knowledge gap.

What is known about the role of mug70 in meiotic progression in S. pombe?

  • Sexual differentiation: S. pombe cells convert from mitosis to meiosis under nitrogen starvation conditions, developing into spores via pheromone communication . Being upregulated during this process, mug70 may participate in this differentiation pathway.

  • Spore formation: By comparison with Mug27, which regulates forespore membrane formation and sporulation , mug70 might have a role in spore morphogenesis or maturation.

  • Chromosome dynamics: Given S. pombe's role as a model for studying chromosome mechanics, mug70 could potentially function in chromosome pairing, recombination, or segregation during meiosis.

Further research is needed to elucidate the specific molecular function of mug70 in meiotic progression, representing an opportunity for researchers in this field.

How can recombinant mug70 protein be efficiently expressed and purified?

Based on available information, recombinant Schizosaccharomyces pombe mug70 protein can be produced and processed as follows:

Expression System:

  • E. coli is the reported expression system for recombinant mug70

  • Partial protein expression rather than full-length appears to be the common approach

Purification and Storage:

  • Purification can achieve >85% purity as assessed by SDS-PAGE

  • The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% being standard) and aliquot for storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, as this may affect protein stability

  • Working aliquots can be stored at 4°C for up to one week

Storage Stability:

  • Liquid form: approximately 6 months shelf life at -20°C/-80°C

  • Lyophilized form: approximately 12 months shelf life at -20°C/-80°C

Researchers should note that the optimal expression and purification conditions may need to be empirically determined based on the specific experimental requirements and the particular construct being used.

What experimental approaches can be used to study the phosphorylation status of mug70?

Given the extensive phosphorylation of mug70 at multiple sites, several methodological approaches can be employed to study its phosphorylation:

  • Mass Spectrometry-Based Phosphoproteomics:

    • Utilize tandem mass spectrometry (MS/MS) for identification and quantification of phosphorylation sites

    • Employ stable isotope labeling with amino acids in cell culture (SILAC) to compare phosphorylation profiles between different meiotic stages

    • Use phosphopeptide enrichment strategies (TiO₂, IMAC) to improve detection of phosphorylated residues

  • Phospho-specific Antibodies:

    • Develop antibodies against key phosphorylation sites (particularly those with high conservation or appearing in multiple studies, such as S14, S51, S223, and S687)

    • Use these antibodies for Western blotting, immunofluorescence, or ChIP experiments to track phosphorylation dynamics during meiosis

  • Phosphorylation Site Mutagenesis:

    • Generate point mutations (S/T to A for phospho-null or S/T to D/E for phospho-mimetic) at key phosphorylation sites

    • Create combined mutations of clustered phosphorylation sites

    • Assess the impact of these mutations on mug70 function, localization, and interaction partners during meiosis

  • Kinase Inhibitor Screens:

    • Use selective kinase inhibitors to identify the regulatory kinases responsible for mug70 phosphorylation

    • Combine with phospho-specific antibodies or mass spectrometry to monitor changes in phosphorylation status

These approaches would provide insights into the dynamic regulation of mug70 during meiotic progression and help elucidate its function.

How can researchers use S. pombe and mug70 as a model for studying analogous processes in human cells?

Researchers can leverage S. pombe and specifically mug70 to study processes relevant to human biology through several methodological approaches:

  • Comparative Genomics and Proteomics:

    • Identify human orthologs or proteins with similar domain structures to mug70

    • Analyze the conservation of phosphorylation sites between mug70 and human proteins

    • Examine if human orthologs are also regulated during meiosis or related processes

  • Heterologous Expression Systems:

    • Express human proteins in S. pombe to study their function in a simplified eukaryotic system

    • Utilize the GPCR reporter system in fission yeast to study human GPCRs and signaling pathways

    • Create chimeric proteins combining domains from mug70 and human proteins to study domain function

  • Genetic Manipulation Strategies:

    • Create deletion mutants (mug70Δ) to assess phenotypic consequences

    • Perform complementation studies with human genes to test functional conservation

    • Utilize the relatively easy genetic manipulation of S. pombe to model human disease mutations

  • High-throughput Screening Applications:

    • Develop mug70-based reporters for monitoring meiotic progression

    • Screen for compounds that affect mug70 phosphorylation or function

    • Use these screens to identify potential modulators of analogous human processes

Given that S. pombe is considered a "micro-mammalian" model organism with many processes similar to human cells , findings from mug70 studies could provide valuable insights into fundamental mechanisms of human cell division, differentiation, and disease.

What are the major knowledge gaps in understanding mug70 function?

Despite the available information on mug70, several significant knowledge gaps persist:

  • Precise Molecular Function: The exact molecular function of mug70 during meiosis remains unclear. While we know it is upregulated during meiosis, its specific role in meiotic progression has not been well-characterized .

  • Structural Information: The three-dimensional structure of mug70 is not reported in the search results, limiting our understanding of how phosphorylation might affect its function through structural changes.

  • Interaction Partners: The protein-protein interaction network of mug70 is not well-defined. Identifying binding partners would provide insights into the pathways and processes in which mug70 participates.

  • Regulation Mechanisms: While extensive phosphorylation has been documented, the kinases and phosphatases that regulate mug70, as well as the signaling pathways that control these enzymes, remain to be elucidated.

  • Evolutionary Conservation: The extent to which mug70 function is conserved in other eukaryotes, including humans, is not clear from the available information.

Addressing these knowledge gaps represents important directions for future research on mug70.

How can advanced techniques enhance our understanding of mug70?

Several cutting-edge methodologies could significantly advance our understanding of mug70:

  • CRISPR-Cas9 Gene Editing:

    • Create precise point mutations at phosphorylation sites

    • Generate fluorescently tagged endogenous mug70 for live cell imaging

    • Develop conditional degron systems for rapid protein depletion studies

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determine the three-dimensional structure of mug70 in different phosphorylation states

    • Visualize mug70 in complex with its interaction partners

    • Understand structural changes during meiotic progression

  • Proximity Labeling Proteomics:

    • Employ BioID or APEX2 fusion proteins to identify proximal proteins in the mug70 interactome

    • Map dynamic changes in the mug70 interaction network during meiotic progression

    • Identify potential regulators and effectors of mug70 function

  • Single-Cell Approaches:

    • Apply single-cell RNA-seq to track expression patterns during meiosis

    • Use single-molecule tracking to observe mug70 dynamics in living cells

    • Implement optogenetic approaches to control mug70 function with spatial and temporal precision

  • Systems Biology Integration:

    • Generate comprehensive phosphoproteomics data across meiotic time points

    • Integrate transcriptomic, proteomic, and metabolomic data to place mug70 in the broader context of meiotic regulation

    • Develop predictive models of mug70 function and regulation

These advanced techniques would provide multi-dimensional insights into mug70 biology and its role in meiotic progression.

Why is continued research on mug70 and related proteins important?

Research on mug70 and related meiotic proteins in S. pombe carries significant implications for broader scientific understanding:

  • Fundamental Cellular Processes: Studying mug70 contributes to our understanding of meiosis, a fundamental process in sexual reproduction across eukaryotes.

  • Model System Advantages: S. pombe offers unique advantages as a model organism, being described as "micro-mammalian" with many processes similar to human cells . This makes findings potentially translatable to higher organisms.

  • Evolutionary Insights: Understanding the role of mug70 in S. pombe meiosis can provide evolutionary insights into the conservation and divergence of meiotic mechanisms across species.

  • Biomedical Applications: The similarities between S. pombe and human cellular processes may allow findings from mug70 research to inform our understanding of human reproductive biology and disorders.

  • Technological Development: Research on proteins like mug70 drives the development of new methodologies and tools that benefit the broader scientific community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.