Recombinant Schizosaccharomyces pombe Meiotically Up-Regulated Gene 70 Protein (Mug70) is a protein that is up-regulated during meiosis in the fission yeast Schizosaccharomyces pombe . Mug70 is conserved in both fungi and plants and implicated in signaling . It contains both a CBS (cystathionine-beta-synthase) domain and a PB1 (Phox and Bem1) domain .
Mug70 contains a PB1 domain, which ranges from 80 to 100 amino acids in length and exhibits a Ubiquitin-like β-grasp fold with five β-sheets and two α-helices . The β-grasp fold is widespread in nature and is present in more than 60 distinct protein families across eukaryotes . PB1 domains are known to mediate protein-protein interactions that are important for innate immunity and cell polarity .
The PB1 domain can be divided into three types based on the presence or absence of conserved motifs. Type-1 PB1 domains contain only the conserved OPCA motif, type-2 PB1 domains contain only a conserved lysine (K) residue in β1, and type-1/2 PB1 domains contain both the lysine and the OPCA motifs .
Recombinant Mug70 is produced in a heterologous expression system and purified to homogeneity .
Tag Info: The tag type is determined during the production process .
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .
Mug70 is known to have a role in meiosis . A study found that Mug70 binds a DNA-binding domain construct with, gpc1, glycerophosphocholine acyltransferase (GPCAT) Gpc1 .
The amino acid sequence of Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 70 protein(mug70) is :
MTVGTLSVVSSTASDTASHVSDTRKRQYQRDEALRKKIISELGKKSGNFESPVRKIRRNG
EPGTVDSAALDPALTVHMQSLVTETAQLMAAKRQNCVLVVDDDEQLAGIVTATDIATRCV
GAGLNARQTLIADIMSTSPLCITSDTRFDDALLLMIEHKFRHLPVVSDGGPDGSAGDEGD... VIGIINMRACLREPLNRIARQQEAAQKLVEALEGAQEEIENKSVSGNTNSSSVSGNHAAE
FLEYVESLKKKASGLEIMSLIDSSEEPFLVGTRTTVAEATESMARSGVSAVLVMDNGAVS
GVFTAHDVVLRVLAAGLDPYRSSVIRVMTPHPDCALASLRVSTALERMIEGKFSNLPVVD
ESDAIIGMLSLFHLATAIEQTPEEEEEVFDQAENDAGIEPSNGFEDQQQQLLGNSNEVVE
NYDVNPPLPLNPLPSNTQQSESTYEYSARQLPKPPVQAWQNENLSSNNKPQEYVGVENDY
NFSNNPPTAMSEQSFHPSVSQKPMDTPENGSNSFAASPYLQPYNSASQLAPSYVGSLPQY
HGNPSFVEQALQDLVQPTDSASQIFPLNPQSPSQFTIKYRSIAGRVHRLRLDGINSVSDL
RTAVEEREKEQLVTLTYIDDEGDVVELVSDSDLREAILLARRRGLPRLEVRGVAAFTNHL... ESSHPPISTVDSSIGSASVVEKGVANSIVDIHQPTAKADKGNSKKPIYIGIVSSSIVILA
VSMWYLRRKR
Plays a role in meiosis.
KEGG: spo:SPAC24C9.05c
STRING: 4896.SPAC24C9.05c.1
Mug70 (Meiotically up-regulated gene 70 protein) is a protein encoded by the mug70 gene (also known as SPAC24C9.05c) in Schizosaccharomyces pombe, commonly known as fission yeast . This protein is specifically upregulated during meiosis, suggesting its important role in sexual reproduction in this organism . S. pombe is a unicellular eukaryote that serves as an excellent model organism for studying fundamental cellular processes due to its similarity to higher eukaryotes in numerous molecular mechanisms, including cell cycle regulation, chromosome structure, and meiosis .
Mug70 protein has several notable characteristics:
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Function: The protein is upregulated during meiosis, suggesting a role in sexual reproduction
Post-translational modifications: Extensive phosphorylation at multiple sites (see Table 1)
| Site | PTM Type | Source | Referenced in PMIDs |
|---|---|---|---|
| T2 | Phosphorylation | PomBase | 30726745 |
| T5 | Phosphorylation | PomBase | 30726745 |
| S10 | Phosphorylation | PomBase | 29996109 |
| T12 | Phosphorylation | PomBase | 29996109 |
| S14 | Phosphorylation | PomBase | 21712547, 30726745, 29996109 |
| S51 | Phosphorylation | PomBase | 24763107, 33823663, 29996109, 30726745, 21712547, 25720772 |
| S223 | Phosphorylation | PomBase | 30726745, 21712547, 33823663 |
| S687 | Phosphorylation | PomBase | 21712547, 24763107, 29996109, 25720772, 30726745 |
Schizosaccharomyces pombe has been described as a "micro-mammalian" model organism due to its remarkable similarities with metazoan species, making it valuable for understanding human disease mechanisms . These similarities include:
Chromosomal structure and complexity similar to higher eukaryotes
Relatively large chromosomes and centromeres
Low-complexity replication origins
Epigenetic mechanisms for regulation of gene expression and centromere maintenance
G2/M control of cell cycle, similar to human cells
DNA repair and recombination mechanisms comparable to humans
Spliceosome components with functional alternative splicing
RNA interference (RNAi) machinery
Post-translational modification systems that mirror many human processes
These features make proteins like mug70 and the cellular processes they participate in relevant to understanding fundamental mechanisms that may be conserved in human cells.
Mug70 undergoes extensive phosphorylation at multiple sites, with at least 21 documented phosphorylation sites . The protein shows clusters of phosphorylation, particularly at the N-terminus (T2, T5, S10, T12, S14, T16, S18, S21) and in the region from S223-S234 . The extensive phosphorylation of mug70 suggests regulation by kinase cascades, potentially involved in meiotic progression.
These phosphorylation events may facilitate several functions:
Temporal regulation of protein activity during meiotic progression
Protein-protein interactions with meiotic apparatus components
Subcellular localization changes in response to meiotic progression
Structural modifications affecting protein function
While the specific kinases responsible for mug70 phosphorylation remain unidentified, the clustered nature of phosphorylation sites suggests potential regulation through mechanisms similar to those observed in other meiotic proteins such as Mug27, which is a meiosis-specific protein kinase involved in spore formation .
Although the search results don't provide direct comparisons between mug70 and other meiotically upregulated genes, we can draw some insights by comparing with the better-characterized Mug27 (also known as Ppk35) :
Temporal expression: Like mug70, Mug27 is specifically expressed during meiosis, with transcription beginning after horsetail movement and continuing through the second meiotic division .
Function: Mug27 is a protein kinase essential for proper spore formation. When deleted (mug27Δ), cells produce smaller spores with reduced viability . The function of mug70 is less well-characterized, but its meiotic upregulation suggests a role in spore development or meiotic progression.
Localization: Mug27 localizes to the spindle pole body (SPB) in early meiosis and later translocates to the forespore membrane (FSM) at late anaphase II . The localization pattern of mug70 is not specified in the search results, representing a knowledge gap.
Sexual differentiation: S. pombe cells convert from mitosis to meiosis under nitrogen starvation conditions, developing into spores via pheromone communication . Being upregulated during this process, mug70 may participate in this differentiation pathway.
Spore formation: By comparison with Mug27, which regulates forespore membrane formation and sporulation , mug70 might have a role in spore morphogenesis or maturation.
Chromosome dynamics: Given S. pombe's role as a model for studying chromosome mechanics, mug70 could potentially function in chromosome pairing, recombination, or segregation during meiosis.
Further research is needed to elucidate the specific molecular function of mug70 in meiotic progression, representing an opportunity for researchers in this field.
Based on available information, recombinant Schizosaccharomyces pombe mug70 protein can be produced and processed as follows:
Expression System:
E. coli is the reported expression system for recombinant mug70
Partial protein expression rather than full-length appears to be the common approach
Purification and Storage:
Purification can achieve >85% purity as assessed by SDS-PAGE
The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL
For long-term storage, add glycerol to a final concentration of 5-50% (50% being standard) and aliquot for storage at -20°C/-80°C
Avoid repeated freeze-thaw cycles, as this may affect protein stability
Storage Stability:
Liquid form: approximately 6 months shelf life at -20°C/-80°C
Lyophilized form: approximately 12 months shelf life at -20°C/-80°C
Researchers should note that the optimal expression and purification conditions may need to be empirically determined based on the specific experimental requirements and the particular construct being used.
Given the extensive phosphorylation of mug70 at multiple sites, several methodological approaches can be employed to study its phosphorylation:
Mass Spectrometry-Based Phosphoproteomics:
Utilize tandem mass spectrometry (MS/MS) for identification and quantification of phosphorylation sites
Employ stable isotope labeling with amino acids in cell culture (SILAC) to compare phosphorylation profiles between different meiotic stages
Use phosphopeptide enrichment strategies (TiO₂, IMAC) to improve detection of phosphorylated residues
Phospho-specific Antibodies:
Phosphorylation Site Mutagenesis:
Generate point mutations (S/T to A for phospho-null or S/T to D/E for phospho-mimetic) at key phosphorylation sites
Create combined mutations of clustered phosphorylation sites
Assess the impact of these mutations on mug70 function, localization, and interaction partners during meiosis
Kinase Inhibitor Screens:
Use selective kinase inhibitors to identify the regulatory kinases responsible for mug70 phosphorylation
Combine with phospho-specific antibodies or mass spectrometry to monitor changes in phosphorylation status
These approaches would provide insights into the dynamic regulation of mug70 during meiotic progression and help elucidate its function.
Researchers can leverage S. pombe and specifically mug70 to study processes relevant to human biology through several methodological approaches:
Comparative Genomics and Proteomics:
Identify human orthologs or proteins with similar domain structures to mug70
Analyze the conservation of phosphorylation sites between mug70 and human proteins
Examine if human orthologs are also regulated during meiosis or related processes
Heterologous Expression Systems:
Genetic Manipulation Strategies:
Create deletion mutants (mug70Δ) to assess phenotypic consequences
Perform complementation studies with human genes to test functional conservation
Utilize the relatively easy genetic manipulation of S. pombe to model human disease mutations
High-throughput Screening Applications:
Develop mug70-based reporters for monitoring meiotic progression
Screen for compounds that affect mug70 phosphorylation or function
Use these screens to identify potential modulators of analogous human processes
Given that S. pombe is considered a "micro-mammalian" model organism with many processes similar to human cells , findings from mug70 studies could provide valuable insights into fundamental mechanisms of human cell division, differentiation, and disease.
Despite the available information on mug70, several significant knowledge gaps persist:
Precise Molecular Function: The exact molecular function of mug70 during meiosis remains unclear. While we know it is upregulated during meiosis, its specific role in meiotic progression has not been well-characterized .
Structural Information: The three-dimensional structure of mug70 is not reported in the search results, limiting our understanding of how phosphorylation might affect its function through structural changes.
Interaction Partners: The protein-protein interaction network of mug70 is not well-defined. Identifying binding partners would provide insights into the pathways and processes in which mug70 participates.
Regulation Mechanisms: While extensive phosphorylation has been documented, the kinases and phosphatases that regulate mug70, as well as the signaling pathways that control these enzymes, remain to be elucidated.
Evolutionary Conservation: The extent to which mug70 function is conserved in other eukaryotes, including humans, is not clear from the available information.
Addressing these knowledge gaps represents important directions for future research on mug70.
Several cutting-edge methodologies could significantly advance our understanding of mug70:
CRISPR-Cas9 Gene Editing:
Create precise point mutations at phosphorylation sites
Generate fluorescently tagged endogenous mug70 for live cell imaging
Develop conditional degron systems for rapid protein depletion studies
Cryo-Electron Microscopy (Cryo-EM):
Determine the three-dimensional structure of mug70 in different phosphorylation states
Visualize mug70 in complex with its interaction partners
Understand structural changes during meiotic progression
Proximity Labeling Proteomics:
Employ BioID or APEX2 fusion proteins to identify proximal proteins in the mug70 interactome
Map dynamic changes in the mug70 interaction network during meiotic progression
Identify potential regulators and effectors of mug70 function
Single-Cell Approaches:
Apply single-cell RNA-seq to track expression patterns during meiosis
Use single-molecule tracking to observe mug70 dynamics in living cells
Implement optogenetic approaches to control mug70 function with spatial and temporal precision
Systems Biology Integration:
Generate comprehensive phosphoproteomics data across meiotic time points
Integrate transcriptomic, proteomic, and metabolomic data to place mug70 in the broader context of meiotic regulation
Develop predictive models of mug70 function and regulation
These advanced techniques would provide multi-dimensional insights into mug70 biology and its role in meiotic progression.
Research on mug70 and related meiotic proteins in S. pombe carries significant implications for broader scientific understanding:
Fundamental Cellular Processes: Studying mug70 contributes to our understanding of meiosis, a fundamental process in sexual reproduction across eukaryotes.
Model System Advantages: S. pombe offers unique advantages as a model organism, being described as "micro-mammalian" with many processes similar to human cells . This makes findings potentially translatable to higher organisms.
Evolutionary Insights: Understanding the role of mug70 in S. pombe meiosis can provide evolutionary insights into the conservation and divergence of meiotic mechanisms across species.
Biomedical Applications: The similarities between S. pombe and human cellular processes may allow findings from mug70 research to inform our understanding of human reproductive biology and disorders.
Technological Development: Research on proteins like mug70 drives the development of new methodologies and tools that benefit the broader scientific community.