Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 89 protein (mug89)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mug89; SPBC1773.11c; Meiotically up-regulated gene 89 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug89
Target Protein Sequence
MPEALNENVSDTASNGPVAKTRAPPNTSFRQQRIKSWQPLLTPKIVLPLFFVLGIIFGPL GGGLLYASSIVQELVVDYTDCETLASYDEFSAVPSKKYTASFDQSGTIGFDKESTYWKLE KILDKDLDMDVNYCIIRFTVPSVLKAPIFIYYRLTNFFQNHRRYAKSVDEKQLQGVALTA DEVKGGNCFPLEVNEDDKPYYPCGLIANSLFNDTFSSLRLLDDNSVYTFSTKNIAWASDK RRFLKTNYSPDDVAPPPNWVLRYPDGYTESNMPDLSTMENLQVWMRTAGLPTFSKLAMRN DNDDIFPGTYEIKIGLFFPVKSFDGTKSLVLTTRSVLGGKNPFLGIAYIVVSAVCVVLGT VFTLRHFIRPRKLADHRYLNWDSEENNLAPHLSDRP
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of mug89 protein in Schizosaccharomyces pombe?

Mug89 is part of the meiotically up-regulated gene family in S. pombe, which plays critical roles in meiotic processes. Like other mug proteins (such as mug1 and mug5), mug89 is likely involved in chromosome segregation during meiosis. Mutant strains may exhibit aberrant asci, indicating problems with chromosome segregation . The protein is expressed specifically during meiosis through the regulation of RNA processing mechanisms similar to those controlled by Mmi1, which binds to primary transcripts of meiotic genes and prevents their expression during vegetative growth .

How is mug89 expression regulated during the cell cycle?

Mug89 expression is tightly regulated by RNA-processing mechanisms during the cell cycle. During vegetative growth, the RNA binding protein Mmi1 targets the mug89 transcript by binding to specific sequence motifs (likely including the U(U/C/G)AAAC motif), which promotes hyperadenylation and subsequent degradation by the nuclear exonuclease Rrp6 . This post-transcriptional regulation ensures that mug89 protein is only expressed during meiosis when Mmi1 is inactivated, allowing proper splicing and stabilization of the mRNA. This regulatory mechanism is similar to how Mmi1 controls at least 29 other meiotic genes in S. pombe .

What experimental approaches are commonly used to study mug89 in S. pombe?

Several experimental approaches can be used to study mug89:

  • Genetic Deletion and Mutation Analysis: Creating mug89Δ mutants using homologous recombination techniques to assess phenotypic effects on meiosis.

  • Expression Profiling: Monitoring mug89 mRNA and protein levels during vegetative growth and meiotic progression using RT-qPCR and Western blotting.

  • Protein Localization: Using fluorescent protein tagging (GFP/RFP fusion constructs) to visualize mug89 cellular localization during meiosis.

  • Chromatin Immunoprecipitation (ChIP): Determining if mug89 associates with chromosomes during specific meiotic stages.

  • Protein-Protein Interaction Studies: Employing yeast two-hybrid screens or co-immunoprecipitation experiments to identify mug89 binding partners.

These approaches leverage S. pombe's genetic tractability, which makes it especially well-suited for both genetic and biochemical analysis of meiotic processes .

How can I generate recombinant mug89 protein for in vitro studies?

To generate recombinant mug89 protein:

  • Cloning Strategy:

    • Amplify the mug89 coding sequence from S. pombe genomic DNA or cDNA

    • Insert into an appropriate expression vector (pET or pGEX systems work well)

    • Include a purification tag (His6, GST, or MBP) to facilitate purification

  • Expression System Options:

    SystemAdvantagesDisadvantages
    E. coliHigh yield, simpleMay lack proper folding for yeast proteins
    S. pombeNative modificationsLower yield, more complex
    Insect cellsBetter folding than E. coliMore expensive, longer process
  • Purification Protocol:

    • For His-tagged protein: Use Ni-NTA chromatography

    • For GST-fusion: Use glutathione sepharose

    • Follow with size exclusion chromatography for higher purity

    • Verify protein integrity by SDS-PAGE and mass spectrometry

  • Functional Validation:

    • Assess protein folding using circular dichroism

    • Test for expected biochemical activities based on predicted functions4

What are the best methods to study mug89's role in meiotic recombination?

To study mug89's role in meiotic recombination, consider these methodological approaches:

  • Genetic Recombination Assays:

    • Create intragenic or intergenic recombination substrates in S. pombe strains

    • Design assays similar to those used for mitotic recombination studies in S. pombe

    • Compare recombination frequencies between wild-type and mug89Δ strains

  • Physical Analysis of Recombination Intermediates:

    • Use pulsed-field gel electrophoresis to detect DSBs

    • Employ 2D gel electrophoresis to analyze joint molecule formation

    • Assess whether single Holliday junction or double Holliday junction intermediates predominate in mug89 mutants

  • Cytological Analysis:

    • Visualize meiotic chromosome structures using immunofluorescence microscopy

    • Use antibodies against recombination proteins (Rec12, Rad51) to assess recombination foci formation

    • Quantify synapsis defects using markers for the linear elements (LinEs), which are the S. pombe equivalent of the synaptonemal complex

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq):

    • Map mug89 binding sites across the genome

    • Compare with known recombination hotspots like M26

    • Analyze associations with other meiotic proteins

These methods take advantage of S. pombe's suitability for both genetic and biochemical analysis of meiotic recombination .

How can I design experiments to determine if mug89 is regulated by Mmi1?

To determine if mug89 is regulated by Mmi1, design the following experiments:

  • RNA Expression Analysis:

    • Compare mug89 RNA levels in wild-type vs. mmi1-ts3 temperature-sensitive mutants

    • Use RT-qPCR or RNA-seq to quantify expression changes

    • Include rrp6-9 exonuclease mutants to test for RNA degradation effects

  • Sequence Motif Analysis:

    • Search for the U(U/C/G)AAAC motif in the mug89 transcript, which is overrepresented in Mmi1 targets

    • Mutate identified motifs and assess effects on mug89 expression

  • RNA Immunoprecipitation (RIP):

    • Perform RIP with tagged Mmi1 protein

    • Use qPCR to detect enrichment of mug89 transcripts

    • Compare with known Mmi1 targets as positive controls

  • Splicing Analysis:

    • Analyze intron retention in mug89 transcripts in wild-type vs. mmi1 mutants

    • Use RT-PCR spanning intron-exon boundaries

    • Determine if Mmi1 specifically regulates splicing of certain introns based on proximity to binding sites

  • PolyA Tail Length Assessment:

    • Compare polyA tail lengths of mug89 transcripts in wild-type vs. mmi1 mutants

    • Look for hyperadenylation (up to 1 kb) in conditions where Mmi1 is active

    • Test dependence on Pab2 (nuclear polyA binding protein)

These experimental approaches will provide comprehensive evidence for Mmi1-mediated regulation of mug89 .

How does mug89 interact with the DSB machinery during meiotic recombination?

Understanding mug89's interaction with the double-strand break (DSB) machinery requires sophisticated experimental approaches:

  • Protein Interaction Network Analysis:

    • Perform immunoprecipitation-mass spectrometry (IP-MS) using tagged mug89

    • Test direct interactions with key DSB proteins including:

      • Rec12 (Spo11 homolog), which forms the catalytic core of the DSB machinery

      • Associated proteins like Rec6, Rec7, Rec14, Rec15, Rec24, Rec25, Rec27

  • DSB Formation Assays:

    • Quantify DSB formation in mug89Δ mutants using Southern blotting

    • Analyze timing and distribution of DSBs across the genome using ChIP-seq for Rec12

    • Examine whether mug89 affects the chromatin environment at DSB hotspots

  • Functional Domain Analysis:

    DomainPredicted FunctionExperimental Approach
    N-terminalProtein interactionTruncation analysis, Y2H
    Middle regionDNA bindingEMSA, ChIP
    C-terminalRegulatoryPhosphorylation studies
  • Chromatin Structure Analysis:

    • Assess chromatin accessibility at recombination hotspots in mug89 mutants

    • Determine if mug89 affects histone modifications that promote DSB formation

    • Analyze nuclear "horsetail" movement and chromosome alignment in mug89 mutants

These approaches will help determine whether mug89 functions upstream, downstream, or independently of the DSB machinery during meiotic recombination .

What is the relationship between mug89 and chromosome synapsis during meiosis?

To investigate the relationship between mug89 and chromosome synapsis:

  • Cytological Analysis of Synapsis:

    • Use immunofluorescence to visualize linear elements (LinEs) in S. pombe, which are analogous to the synaptonemal complex in other organisms

    • Compare LinE formation and structure between wild-type and mug89Δ strains

    • Quantify synapsis defects, especially at recombination hotspots

  • Genetic Interaction Studies:

    • Create double mutants of mug89 with known synapsis proteins

    • Analyze synthetic phenotypes that might reveal functional relationships

    • Test genetic interactions with rec10, rec25, rec27, and mug20, which are components of LinEs

  • High-Resolution Microscopy:

    • Use structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) to analyze fine details of chromosome structure

    • Compare wild-type and mug89Δ strains during prophase I stages

  • Chromatin Conformation Capture:

    • Apply Hi-C technology to map chromosome interactions during meiosis

    • Compare interchromosomal and intrachromosomal interactions in wild-type vs. mug89Δ strains

    • Identify specific chromosome regions where synapsis is affected by mug89 deletion

These approaches will clarify whether mug89 directly participates in synapsis or indirectly affects it through other meiotic processes .

How does mug89 expression correlate with other meiotically up-regulated genes?

To study the co-expression patterns of mug89 with other meiotically up-regulated genes:

  • Transcriptome Time-Course Analysis:

    • Perform RNA-seq at multiple timepoints during meiotic progression

    • Create expression clusters to identify genes with similar expression patterns to mug89

    • Determine if mug89 belongs to early, middle, or late meiotic expression waves

  • Co-expression Network Analysis:

    • Construct gene co-expression networks from meiotic time-course data

    • Identify gene modules that include mug89

    • Analyze functional enrichment of co-expressed genes

  • Regulatory Element Analysis:

    • Compare promoter regions of mug89 and other meiotically up-regulated genes

    • Identify shared transcription factor binding sites

    • Verify regulatory interactions using ChIP-seq for relevant transcription factors

  • Comparative Analysis with Other Mug Proteins:

    GeneExpression TimingFunctionRegulatory Mechanism
    mug1Early meiosisChromosome segregationMmi1-dependent
    mug5Early meiosisChromosome segregationMmi1-dependent
    mug89[Timing to be determined][Function to be determined]Likely Mmi1-dependent
    Other mugsVariousVariousVarious

How can I resolve issues with low expression of recombinant mug89 protein?

If experiencing low expression of recombinant mug89:

  • Codon Optimization:

    • Analyze codon usage in the mug89 gene compared to the expression host

    • Optimize codons to match host preference without changing amino acid sequence

    • Consider rare codons that might cause translational pausing

  • Expression Conditions Optimization:

    ParameterVariables to TestNotes
    Temperature16°C, 25°C, 30°CLower temperatures may improve folding
    Induction time4h, 8h, overnightLonger isn't always better
    Inducer concentration0.1mM to 1mM IPTGTitrate to find optimal level
    Media compositionLB, TB, auto-inductionRich media may improve yield
  • Solubility Enhancement Strategies:

    • Use solubility-enhancing fusion tags (MBP, SUMO, NusA)

    • Add low concentrations of non-ionic detergents

    • Include molecular chaperones by co-expressing GroEL/GroES

  • Cell Lysis Optimization:

    • Test different lysis buffers with varying salt concentrations

    • Include stabilizing agents such as glycerol or specific metal ions

    • Use gentle lysis methods to preserve protein structure

  • Protein Stabilization:

    • Identify potential degradation signals in the mug89 sequence

    • Include protease inhibitors during purification

    • Test protein stability at different pH and temperature conditions4

How do I analyze contradictory phenotypic data from mug89 mutant studies?

When faced with contradictory phenotypic data from mug89 mutant studies:

  • Strain Background Analysis:

    • Compare genetic backgrounds of different strains used

    • S. pombe lab strains are mostly derived from a single culture, but variations can exist

    • Sequence confirm the mug89 locus and surrounding regions in all strains

  • Mutation Type Comparison:

    • Distinguish between null mutations, point mutations, and truncations

    • Compare deletion mutants vs. tagged protein versions

    • Assess whether different mutations affect specific protein domains

  • Experimental Condition Standardization:

    • Standardize meiotic induction methods

    • Control temperature, nutritional status, and cell density

    • Ensure synchronous entry into meiosis across experiments

  • Quantitative Phenotype Assessment:

    • Use quantitative metrics rather than binary outcomes

    • For example, measure the percentage of asci with aberrant morphology

    • Apply statistical analysis to determine significance of differences

  • Genetic Interaction Testing:

    • Create double mutants with known meiotic regulators

    • Test if phenotypic contradictions are due to suppressor mutations

    • Identify genetic background modifiers

By systematically addressing these factors, you can resolve contradictions and develop a more accurate understanding of mug89 function 4.

What statistical approaches are most appropriate for analyzing mug89 recombination frequency data?

When analyzing mug89 recombination frequency data:

  • Appropriate Statistical Tests:

    Data TypeRecommended TestApplication
    Recombination frequenciesChi-square testCompare observed vs. expected frequencies
    Continuous measurementst-test/ANOVACompare means between groups
    Non-normally distributed dataMann-Whitney/Kruskal-WallisNon-parametric comparisons
    Categorical outcomesFisher's exact testSmall sample comparisons
  • Multiple Testing Correction:

    • Apply Bonferroni correction for stringent control of false positives

    • Consider False Discovery Rate (FDR) methods for genome-wide analyses

    • Report both raw and adjusted p-values for transparency

  • Effect Size Calculation:

    • Calculate genetic distance in centiMorgans (cM)

    • Report fold-changes in recombination frequency

    • Include confidence intervals for all measurements

  • Hotspot Analysis:

    • Use kernel density estimation to identify recombination hotspots

    • Compare hotspot distribution between wild-type and mug89 mutants

    • Apply clustering algorithms to identify regions with similar behavior

  • Visualization Approaches:

    • Create recombination maps across chromosomes

    • Use heat maps to visualize changes in recombination patterns

    • Plot recombination frequencies at known hotspots vs. control regions

These statistical approaches ensure robust analysis of recombination data and facilitate comparison with other studies in the field4 .

How might mug89 function be conserved across different species?

To investigate evolutionary conservation of mug89 function:

  • Comparative Genomics Approach:

    • Identify mug89 homologs in related species using sequence similarity searches

    • Compare domain architecture across different organisms

    • Analyze selection pressure on different regions of the protein

  • Functional Complementation Experiments:

    • Express homologs from other species in S. pombe mug89Δ strains

    • Test ability to rescue meiotic phenotypes

    • Create chimeric proteins to identify functionally conserved domains

  • Conservation Analysis:

    SpeciesHomolog IdentifiedSimilarity (%)Conserved Domains
    S. japonicusYes/NoTBDTBD
    S. octosporusYes/NoTBDTBD
    S. cerevisiaeYes/NoTBDTBD
    H. sapiensYes/NoTBDTBD
  • Expression Pattern Comparison:

    • Compare meiosis-specific expression of homologs across species

    • Analyze conservation of regulatory mechanisms (e.g., Mmi1-like regulation)

    • Determine if the timing of expression during meiosis is conserved

  • Structural Biology Approach:

    • Predict protein structures using AlphaFold or similar tools

    • Compare structural features across species

    • Identify conserved interaction interfaces

This comprehensive approach will reveal how mug89 function has evolved and identify core functions that are conserved across species .

How can CRISPR-Cas9 technology be applied to study mug89 function?

CRISPR-Cas9 technology offers powerful approaches to study mug89:

  • Precise Genome Editing Applications:

    • Create clean deletions without selection markers

    • Introduce point mutations to study specific amino acids

    • Generate epitope tags at the endogenous locus

  • Domain-Specific Mutagenesis:

    • Target specific functional domains for mutation

    • Create truncated versions of mug89

    • Introduce conditional degron tags for temporal control

  • Regulatory Element Analysis:

    • Modify promoter regions to alter expression

    • Mutate potential Mmi1 binding sites

    • Create reporter fusions at the endogenous locus

  • CRISPR Activation/Inhibition:

    • Use CRISPRa to force expression during vegetative growth

    • Apply CRISPRi to repress expression during meiosis

    • Implement temporal control with inducible Cas9 systems

  • High-Throughput Screening:

    • Create sgRNA libraries targeting the mug89 locus

    • Screen for meiotic phenotypes

    • Identify critical residues through deep mutational scanning

These CRISPR-based approaches provide unprecedented precision in studying mug89 function in its native genomic context4 .

What potential therapeutic applications might arise from understanding mug89 function?

While basic research on mug89 is primarily focused on fundamental biological processes, several potential therapeutic applications could emerge:

  • Fertility Applications:

    • If human homologs exist, insights into mug89 function could inform treatments for meiotic defects leading to infertility

    • Understanding regulation of meiotic genes could help develop approaches to modulate gametogenesis

  • Cancer Research Relevance:

    • Aberrant expression of meiotic genes is observed in many cancers

    • Understanding how mug89-like proteins are normally repressed in somatic cells could reveal mechanisms of their reactivation in cancer

    • Potential development of cancer biomarkers based on ectopic expression of meiotic proteins

  • Chromosome Segregation Disorders:

    • Insights into mug89's role in meiotic chromosome segregation could inform understanding of disorders like Down syndrome

    • Understanding the mechanisms preventing chromosome missegregation could have diagnostic applications

  • Drug Discovery Potential:

    ApplicationApproachTimeline
    Fertility diagnosticsBiomarker developmentNear-term
    Contraceptive developmentTarget inhibitionMid-term
    Cancer therapeuticsRepression of ectopic expressionLong-term
    Chromosome disorder preventionPathway modulationLong-term
  • Synthetic Biology Applications:

    • Engineering meiotic regulation systems for controlled recombination in biotechnology

    • Developing synthetic genetic circuits based on meiotic regulatory mechanisms

While these applications remain speculative until mug89 function is better understood, they represent potential translational outcomes of this fundamental research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.