Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 96 protein (mug96)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mug96; SPBC1271.06c; Meiotically up-regulated gene 96 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug96
Target Protein Sequence
MVIFSSYFSKQMNRFSTPFVFFFKKLNNTLKKSLQFIMRFHSYHPMFICLLRDSSRNENR KKKVSIGLRTIMRAFSFLMQVATCLIRYSLILTCLVAILLSVLWRIQFAALRMHDLIEEE LKMFVLQHNCTLADLWSGKCPSSEDE
Uniprot No.

Target Background

Function

Plays a role in meiosis.

Database Links
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

How does S. pombe serve as a model organism for studying meiotic proteins like mug96?

S. pombe has emerged as a powerful model organism for several reasons when studying meiotic proteins. Since its adoption as a research organism in the 1940s and 1950s, S. pombe has grown to become one of the best-studied eukaryotes, with its genome fully sequenced in 2002 . It offers several advantages for meiotic studies:

  • Simplified genome: With approximately 4940 protein-coding genes, S. pombe has the smallest number of ORFs in a sequenced eukaryote (as of the early 2000s), making genome-wide studies more tractable .

  • Conservation of meiotic mechanisms: Many meiotic processes in S. pombe are conserved across eukaryotes, making findings potentially applicable to higher organisms.

  • Genetic tractability: The availability of techniques for gene deletion, transformation, and mutation has made S. pombe particularly valuable for functional genomics approaches .

  • Cell cycle control: The pioneering cell-cycle studies by Paul Nurse and colleagues established S. pombe as a premier model for understanding cell division regulation, providing context for meiotic-specific proteins .

For mug96 specifically, S. pombe offers the advantage of allowing researchers to study a protein in its native context, where its meiotic upregulation can be examined in relation to other cellular processes.

What are the recommended methods for expressing and purifying recombinant mug96 protein?

For expression and purification of recombinant mug96 protein, the following methodological approach is recommended:

Expression System Selection:

  • E. coli expression systems are commonly used for recombinant mug96 protein production .

  • The protein is typically expressed with a His-tag to facilitate purification .

Expression and Purification Protocol:

  • Clone the full-length mug96 coding sequence (1-146 amino acids) into an appropriate expression vector.

  • Transform the construct into E. coli expression strain.

  • Induce protein expression using optimal conditions (temperature, inducer concentration, duration).

  • Harvest cells and lyse under conditions that maintain protein stability.

  • Purify using affinity chromatography (IMAC for His-tagged protein).

  • Consider secondary purification steps (ion exchange, size exclusion) if higher purity is required.

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

Storage Considerations:

  • Aliquot the purified protein to avoid repeated freeze-thaw cycles.

  • For working solutions, store aliquots at 4°C for up to one week .

  • Repeated freezing and thawing is not recommended as it may affect protein activity and structure .

How can researchers effectively design deletion mutants for studying mug96 function?

Designing effective deletion mutants for mug96 requires careful consideration of several factors:

PCR-Based Deletion Strategy:

  • Design primers that contain 80-100 bp homology to regions flanking the mug96, followed by 20-25 bp homology to the selection marker.

  • Amplify a selection marker cassette (typically antibiotic resistance genes like kanMX6) using these primers.

  • Transform the PCR product into S. pombe cells.

  • Select transformants on appropriate media containing the selection agent.

  • Verify the deletion by PCR from genomic DNA, using primers that bind outside the targeted region .

Considerations for S. pombe Gene Deletion:

  • Be aware that some chromosomal regions in S. pombe can be refractory to gene deletion using PCR-based approaches. In a pilot study, 8 of 9 genes within an 18 kb region could not be deleted, suggesting potential challenges .

  • The efficiency of correct gene deletion in S. pombe varies widely (5-100%, with an average of 51% based on analysis of geneticin-resistant clones) .

  • Consider the essential nature of genes - approximately 17.5% of S. pombe genes are essential for vegetative growth .

Conditional Deletion Approaches:
For studying meiotic genes like mug96, consider:

  • Using regulatable promoters to control expression timing

  • Creating temperature-sensitive alleles

  • Employing chemical-genetic approaches to inhibit protein function at specific stages

What approaches can be used to determine the role of mug96 in meiotic processes?

To investigate the role of mug96 in meiotic processes, researchers can employ several complementary approaches:

Gene Expression Analysis:

  • Monitor mug96 expression levels during different stages of meiosis using RT-qPCR or RNA-seq.

  • Compare expression patterns with other meiotically upregulated genes to identify co-regulated gene networks.

  • Investigate the regulation of mug96 expression by examining the effects of mutations in meiotic transcription factors.

Protein Localization Studies:

  • Create fluorescently tagged versions of mug96 (e.g., GFP-tagged) to track its localization during meiosis.

  • Perform time-lapse microscopy to monitor dynamic changes in localization throughout the meiotic process.

  • Co-localize with known meiotic structures or proteins to identify potential functional associations.

Genetic Interaction Analysis:

  • Conduct synthetic genetic array (SGA) analysis to identify genetic interactions between mug96 and other genes.

  • Focus on interactions with known meiotic regulators to place mug96 in existing pathways.

  • Analyze the effects of mug96 deletion on meiotic progression and spore formation in combination with other mutations.

Biochemical Approaches:

  • Identify protein interaction partners through co-immunoprecipitation or yeast two-hybrid screening.

  • Characterize post-translational modifications that might regulate mug96 activity during meiosis.

  • Perform in vitro assays to test hypothesized biochemical functions.

Research has shown that meiotic mRNAs, including mug96, can accumulate in mitotic rhn1Δ cells, suggesting that Rhn1 is required for suppression of meiotic mRNAs during mitotic growth . This observation provides a starting point for investigating the regulation and function of mug96.

How does the regulation of mug96 compare to other meiotically upregulated genes in S. pombe?

The regulation of mug96 can be compared to other meiotically upregulated genes in S. pombe through several analytical approaches:

Comparative Expression Analysis:
Research has identified several classes of meiotically upregulated genes in S. pombe, including mug96, moa1+, mcp5+, and others that show accumulation in mitotic rhn1Δ cells . These genes form part of a larger program of meiotic gene expression that is normally suppressed during mitotic growth.

Regulatory Mechanisms:

  • Transcriptional Control: Multiple meiotic genes, including mug96, appear to be regulated by similar transcriptional mechanisms involving the suppression of their expression during mitosis .

  • RNA Processing: The involvement of RNA processing factors like Sen1 (an ATP-dependent 5′-3′ RNA/DNA helicase) in controlling mug96 transcript levels suggests post-transcriptional regulation .

  • Comparative Pathway Analysis: The regulation of mug96 can be placed in the context of known meiotic regulatory pathways, potentially highlighting common or divergent control mechanisms.

Evolutionary Conservation:
When examining mug96 regulation in the broader evolutionary context:

  • S. pombe and S. cerevisiae diverged from their common ancestor approximately 350-420 million years ago, allowing for significant divergence in meiotic regulation .

  • Cross-species comparison can identify conserved elements in the regulation of meiotic genes, potentially highlighting fundamental mechanisms of meiotic control.

How can researchers integrate mug96 studies into broader investigations of meiotic regulation?

Integrating mug96 research into broader meiotic regulation studies requires thoughtful experimental design and data interpretation:

Multi-Omics Approaches:

  • Combine transcriptomics, proteomics, and metabolomics analyses to understand how mug96 functions within the larger network of meiotic regulation.

  • Use computational approaches to model the meiotic regulatory network, incorporating known interactions and expression patterns.

  • Apply systems biology approaches to identify emergent properties of the meiotic regulatory network.

Comparative Genomics:

  • Compare the function and regulation of mug96 with orthologs or functionally similar proteins in other organisms.

  • Investigate whether mug96 represents a conserved or species-specific adaptation for meiotic regulation.

  • Examine the evolutionary history of mug96 and related meiotic regulators to understand the conservation and divergence of meiotic control mechanisms.

Development of Research Frameworks:
When formulating research questions about mug96 in the context of meiotic regulation, consider using the PICO (Population, Intervention, Control, and Outcomes) framework :

  • Population: Define the specific strain(s) of S. pombe being studied

  • Intervention: Specify manipulations of mug96 (deletion, overexpression, mutation)

  • Control: Identify appropriate control conditions or strains

  • Outcomes: Clearly define measurable outcomes related to meiotic progression

This structured approach can help ensure that research questions are well-defined and that experiments are designed to provide meaningful insights into mug96 function within the broader context of meiotic regulation.

What are the methodological challenges in studying proteins like mug96 that function in specific cellular contexts?

Investigating context-specific proteins like mug96 presents several methodological challenges:

Temporal and Spatial Specificity:

  • Capturing the right time window: Since mug96 is meiotically upregulated, timing experiments to capture its relevant activity period is crucial.

  • Developing tools for temporal control: Consider using degron systems, conditional promoters, or other approaches for precise temporal control of protein function.

  • Spatial localization: Develop methods to track and manipulate mug96 in specific subcellular compartments where it functions.

Functional Redundancy:

  • Identify potentially redundant proteins that might mask phenotypes in single-gene deletion studies.

  • Design experiments to address redundancy through multiple gene deletions or domain-specific mutations.

  • Use quantitative rather than qualitative readouts to detect partial loss-of-function effects.

Biochemical Characterization:

  • Protein stability and solubility: Optimize conditions for handling meiotically expressed proteins that may have unique biochemical properties.

  • Identifying transient interactions: Develop approaches to capture short-lived or context-specific protein interactions.

  • Post-translational modifications: Identify and characterize modifications that may be stage-specific during meiosis.

Data Interpretation Challenges:

  • Distinguishing direct from indirect effects: Use acute inhibition or rapid protein depletion to differentiate primary from secondary effects.

  • Correlating in vitro and in vivo findings: Develop assays that bridge biochemical analyses with cellular phenotypes.

  • Integrating multi-omics data: Build computational frameworks to integrate diverse data types for a comprehensive understanding of mug96 function.

What quality control measures should be implemented when working with recombinant mug96 protein?

When working with recombinant mug96 protein, implementing rigorous quality control measures is essential:

Protein Identity and Purity Assessment:

  • Verify protein identity using mass spectrometry to confirm the expected molecular weight and sequence.

  • Assess purity using SDS-PAGE with densitometry analysis (aim for >90% purity for most applications).

  • Consider western blot analysis using anti-His tag antibodies or specific antibodies against mug96 if available .

Functional Validation:

  • Develop activity assays relevant to the hypothesized function of mug96.

  • Assess proper folding using circular dichroism spectroscopy or limited proteolysis.

  • Validate biological activity through relevant functional assays or binding studies with known interaction partners.

Storage and Stability Monitoring:

  • Implement a regular testing schedule to assess protein stability during storage.

  • Monitor potential aggregation using dynamic light scattering or size exclusion chromatography.

  • Document batch-to-batch variation and establish acceptance criteria for experimental use.

Documentation Standards:
Maintain detailed records including:

  • Expression conditions and purification methods

  • Quality control results for each batch

  • Storage conditions and duration

  • Freeze-thaw cycles

  • Results of periodic stability assessments

How can researchers formulate research questions about mug96 that will yield meaningful contributions to the field?

Formulating impactful research questions about mug96 requires careful consideration of existing knowledge gaps and methodological approaches:

Applying the FINER Criteria:
According to established research methodology, a strong research question should meet the FINER criteria (Feasible, Interesting, Novel, Ethical, and Relevant) :

  • Feasible: Ensure that the necessary tools and resources are available to study mug96 effectively.

    • Consider available S. pombe strains, antibodies, and technical expertise.

    • Assess whether the required experiments can be completed within reasonable time and budget constraints.

  • Interesting: Focus on aspects of mug96 that have broad implications for understanding meiotic regulation.

    • Connect mug96 function to larger questions in cell biology.

    • Consider how findings might interest researchers beyond the S. pombe community.

  • Novel: Identify unexplored aspects of mug96 biology.

    • Review current literature thoroughly to identify knowledge gaps.

    • Consider innovative approaches to study mug96 that haven't been applied previously.

  • Ethical: Ensure research adheres to responsible research practices.

    • Consider broader implications of findings for genetic research.

    • Ensure proper attribution of resources and methods.

  • Relevant: Connect mug96 research to broader biological questions.

    • Relate findings to conserved mechanisms across species.

    • Consider relevance to understanding fundamental processes like meiosis and gene regulation.

Refining Research Questions:
When formulating specific research questions about mug96, consider:

  • Moving from descriptive to mechanistic questions (from "what" to "how" and "why").

  • Developing clear hypotheses that can be directly tested with available methods.

  • Constructing questions that build logically on existing knowledge.

  • Creating a systematic research plan that progresses from validation to novel discovery.

How should researchers approach comparative analysis of mug96 with related proteins across species?

Ortholog Identification:

  • Use sequence-based approaches (BLAST, HMM profiles) to identify potential mug96 orthologs in other species.

  • Apply synteny analysis to confirm orthologous relationships, especially in cases of limited sequence conservation.

  • Consider structural prediction tools to identify proteins with similar predicted structures despite sequence divergence.

Functional Conservation Analysis:

  • Compare expression patterns of identified orthologs during meiosis across species.

  • Test functional complementation by expressing orthologs in S. pombe mug96 deletion strains.

  • Analyze conservation of regulatory elements in the promoter regions of mug96 and its orthologs.

Evolutionary Rate Analysis:

  • Calculate evolutionary rates (dN/dS ratios) to identify conserved functional domains.

  • Perform phylogenetic analysis to understand the evolutionary history of mug96.

  • Compare mug96 evolution with that of other meiotic genes to identify co-evolutionary patterns.

Data Visualization and Integration:

  • Develop comparative visualizations that highlight conservation and divergence.

  • Integrate multiple data types (sequence, expression, phenotype) into comprehensive comparative analyses.

  • Use statistical approaches appropriate for cross-species comparisons to account for phylogenetic relationships.

What approaches can resolve contradictory findings in mug96 research?

When faced with contradictory findings in mug96 research, systematic troubleshooting and reconciliation approaches can help:

Methodological Reconciliation:

  • Compare experimental conditions in detail, including strain backgrounds, growth conditions, and assay parameters.

  • Consider genetic background effects that might influence phenotypes.

  • Evaluate the sensitivity and specificity of different assays used to measure the same parameters.

Statistical Considerations:

  • Reassess statistical analyses to ensure appropriate tests were applied.

  • Consider sample sizes and power calculations to determine if studies were adequately powered.

  • Evaluate whether different statistical approaches might reconcile apparently contradictory results.

Alternative Hypotheses Development:

  • Formulate integrative hypotheses that might explain seemingly contradictory results.

  • Consider context-dependency of mug96 function that might explain different outcomes in different experimental settings.

  • Design decisive experiments specifically aimed at resolving contradictions.

Collaborative Approaches:

  • Establish collaborations between groups with contradictory findings to directly compare materials and methods.

  • Implement standardized protocols across laboratories to minimize technical variation.

  • Consider multicenter studies for crucial experiments to ensure reproducibility.

How can researchers optimize S. pombe transformation for difficult genomic regions when studying mug96?

Based on the challenges reported in S. pombe gene manipulation, researchers should consider the following approaches when working with potentially difficult genomic regions:

Optimizing Transformation Efficiency:

  • Evaluate different transformation methods beyond standard lithium acetate procedures, including electroporation or biolistic transformation.

  • Modify homology arm length - increase from the standard 80-100 bp to 200-500 bp for difficult regions.

  • Consider using CRISPR/Cas9 approaches to increase the efficiency of genomic integration at specific loci.

Addressing Regional Challenges:
Previous research has shown that some genomic regions in S. pombe are particularly challenging for gene deletion, with 8 of 9 genes in an 18 kb region being refractory to standard deletion approaches . To address such challenges:

  • Analyze the chromatin state of the mug96 genomic region to determine if heterochromatin or other structural features might impede recombination.

  • Consider a two-step approach where a marker is first inserted near the region of interest, followed by a second transformation to modify the target gene.

  • Evaluate recombination frequency in the region surrounding mug96 before designing transformation strategies.

Alternative Approaches:

  • Use regulatable promoter replacement instead of complete gene deletion.

  • Implement auxin-inducible degron systems for acute protein depletion.

  • Consider RNA interference approaches if direct genomic modification proves challenging.

What are the best practices for designing experiments to study mug96 interactions with other meiotic proteins?

When investigating protein-protein interactions involving mug96, consider these methodological best practices:

In Vivo Interaction Studies:

  • Epitope tagging considerations:

    • Choose tags less likely to interfere with protein function (small epitopes like HA or FLAG).

    • Test multiple tag positions (N-terminal, C-terminal, internal) to minimize functional disruption.

    • Validate that tagged proteins retain wild-type function through complementation tests.

  • Co-immunoprecipitation approaches:

    • Use crosslinking methods optimized for transient interactions.

    • Consider proximity-dependent labeling methods (BioID, APEX) to capture weak or transient interactions.

    • Implement quantitative MS approaches to distinguish specific from non-specific interactions.

In Vitro Interaction Analysis:

  • Protein production considerations:

    • Express proteins in systems that maintain relevant post-translational modifications.

    • Consider co-expression of interaction partners to improve stability and solubility.

    • Validate protein folding and activity before interaction studies.

  • Interaction characterization:

    • Employ multiple complementary methods (pull-downs, SPR, ITC, MST) to validate interactions.

    • Determine binding constants and interaction kinetics for physiologically relevant partners.

    • Map interaction domains through truncation and point mutation analyses.

Network Analysis:

  • Place identified interactions in the context of known meiotic protein networks.

  • Use computational approaches to predict additional interaction partners based on known interactions.

  • Validate key interactions through orthogonal approaches and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.