Recombinant Schizosaccharomyces pombe Membrane-anchored protein 1 (mac1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify this in your order to facilitate preferential development.
Synonyms
mac1; SPAC13G7.04c; Membrane-anchored protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-756
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mac1
Target Protein Sequence
SVSVPSTRMTLAKVEGTEFGIFGTCTGNGTDCTETSFGYNASSSLIDDFYYKGDKRLVLS KVLITHIISAFLSFLSAIFVFFSIFLVNQAVNIINIIVVFITTLLTCLAFAIELVLFLPH NTWQSYVTAGAIGSDLIAILALCLRSVSISRIGQKSARLEHVDTMNSSYSSYKTDVKYPL ALDDKLSSVPTLPKFHDALTSTSEFGPPSDSGDTVGTTQYPGDIKYATGYESTVASPVPS RVAKLSSRDTPSIIADYDEFRKSESSPSRSSVLSTSKPEVHETEGYCPHKTGNRPGFPSL NIPRTRPTTAGIANTQFDLEPYRNRQAGSISSEGTDSRFFDVENQVSVAQTPSVKPEMFP KTARPFAAIHANASSTQLRNTENITHPGIPNHFAKTTSSVFDEPPATRMPQTRSPVNDHS SFPSDLPIKGEMSTNMTGAPRVGSRNNSSNDLHAQAGMLKNVGNGPRNAPRNNSSNNLHA QGGMPMNMRGPRGAPRNNSSGDLHIQSGMPMNGRNGPRDTSRNNSSSDLYAQSGMHPNMN NGHRGAPRNNSSNDLHAHGGMPVNMRGPRNTSRNNSSSEFNAQIPMNLRNGPRNASRSNS STDLFGQSGIPGNSRGMPTSPNSRNNSALDLSMHGIPLANNSRQFKRPSYGNMSRPSFEL NGSRNPSHGSLNTAHAGMGYGPRSMMRDPQNLSNVPPVSNTLDQLSGNADFELPVRGNRN NRRGPGGNRMIR
Uniprot No.

Target Background

Function
Essential for accurate cell separation at elevated temperatures.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell septum. Cell tip.

Q&A

What is Membrane-anchored protein 1 (mac1) in Schizosaccharomyces pombe?

Membrane-anchored protein 1 (mac1) is a transmembrane protein in the fission yeast Schizosaccharomyces pombe with UniProt accession number Q10268. It functions as an integral membrane protein characterized by hydrophobic transmembrane domains that anchor it to cellular membranes. Mac1 contains multiple transmembrane segments with both hydrophilic and hydrophobic regions, allowing it to span the lipid bilayer while maintaining functional domains on either side of the membrane . The protein appears to have structural features consistent with membrane localization, including a stretch of hydrophobic amino acids forming transmembrane domains (e.g., "FLSFLSAIFVFFSIFLVNQAVNIINIIVVFITTLLTCLAFAIELVLFLPH").

What expression systems are optimal for recombinant mac1 production in S. pombe?

For successful expression of recombinant mac1 in S. pombe, researchers should consider:

Vector Selection:
The recently developed stable integration vectors (SIVs) are highly recommended over conventional vectors. These SIVs produce non-repetitive, stable genomic loci and integrate predominantly as single copies, preventing the instability issues observed with traditional vectors that create repetitive regions . When expressing membrane proteins like mac1, stability of the expression construct is particularly crucial for consistent results.

Promoter Considerations:

  • For constitutive expression: The nmt1 promoter and its attenuated versions (nmt41, nmt81) allow for titratable expression levels

  • For inducible expression: The thiamine-repressible system offers tight control, which is particularly valuable when expressing potentially toxic membrane proteins like mac1

Expression Strategy Table:

Expression NeedRecommended SystemAdvantagesConsiderations
High-level expressionStrong nmt1 promoterMaximum protein yieldMay cause aggregation due to membrane saturation
Physiological studiesnmt41/nmt81 (medium/weak)Near-native expression levelsBetter for functional studies
Temporal controlThiamine-repressibleInduction only when needed14-16 hour induction time
Stable cell linesSIV integrationLong-term stabilitySingle-copy integration preferable

The modular toolbox of vectors described in search result provides valuable resources for tailoring the expression system to specific experimental needs when working with challenging membrane proteins like mac1.

What strategies overcome the challenges in purifying functional recombinant mac1?

Purification of membrane proteins like mac1 presents unique challenges:

Solubilization Protocol:

  • Cell disruption: Glass bead lysis in the presence of protease inhibitors is effective for S. pombe

  • Membrane isolation: Differential centrifugation (10,000×g followed by 100,000×g ultracentrifugation)

  • Detergent screening: Test multiple detergents for optimal solubilization

    • Mild detergents (DDM, LMNG): Preserve protein structure but lower yield

    • Stronger detergents (SDS, Triton X-100): Higher yield but risk of denaturation

Recommended Purification Workflow:

  • Affinity chromatography: His-tag or alternative tags should be incorporated during recombinant design

  • Size exclusion chromatography: Separates properly folded protein from aggregates

  • Functional validation: Binding assays or reconstitution experiments

The presence of multiple transmembrane domains in mac1 makes proper folding a critical concern. Researchers should validate protein functionality at each purification stage using structural or functional assays appropriate to membrane proteins. Additionally, consider preserving the lipid environment using nanodiscs or other membrane mimetics to maintain native-like conditions during purification and subsequent analyses.

How can researchers effectively study mac1 localization in S. pombe cells?

Fluorescent Protein Tagging Strategies:
Building on the stable integration vector system described in search result , researchers can generate fluorescently tagged mac1 constructs for localization studies. The paper describes "a large set of ready-to-use, fluorescent probes to mark organelles and cellular processes with a wide range of applications in fission yeast research" . This approach can be adapted for mac1 with the following considerations:

  • Tag position optimization:

    • C-terminal tagging: Less likely to disrupt signal sequences

    • N-terminal tagging: May interfere with membrane insertion

    • Internal tagging: Consider hydrophilic loops between transmembrane domains

  • Verification methods:

    • Co-localization with known membrane markers

    • Subcellular fractionation with western blot analysis

    • Functional complementation assays

Advanced Imaging Techniques:

  • FRAP (Fluorescence Recovery After Photobleaching): To assess mac1 mobility within membranes

  • Super-resolution microscopy: For precise localization beyond diffraction limit

  • Time-lapse imaging: To track dynamic changes in localization during cell cycle or stress response

Researchers should validate that tagged constructs retain functionality by complementation tests in mac1 deletion strains. The integration of fluorescent mac1 should be performed using the stable integration vectors described in to ensure consistent expression levels and prevent genetic instability.

What approaches can determine the protein-protein interaction network of mac1?

In vivo Interaction Methods:

  • Yeast two-hybrid screening: While traditional Y2H has limitations for membrane proteins, modified membrane-based Y2H systems can be effective. Similar approaches have been used to study MAP kinase pathway components in S. pombe, as described in search result which notes: "Our yeast two-hybrid results indicate that Mkh1, Skh1, and Spm1 physically interact to form a ternary complex" .

  • Proximity-based labeling:

    • BioID fusion to mac1 to identify neighboring proteins

    • APEX2-mac1 fusion for spatially resolved proteomics

Biochemical Approaches:

  • Co-immunoprecipitation with detergent-solubilized mac1

  • Crosslinking followed by mass spectrometry (XL-MS)

  • Blue native PAGE to identify native complexes

Data Analysis Framework:

TechniqueAdvantagesLimitationsBest For
Co-IP/MSDirect physical interactionsRequires good antibodiesCore interactions
BioIDWorks in native environmentIdentifies proximal proteins, not just direct interactorsComprehensive interactome
Y2HHigh-throughput screeningFalse positives; challenging for membrane proteinsInitial screening
XL-MSStructural information on interactionsComplex data analysisInteraction interfaces

When interpreting interaction data, researchers should consider that membrane proteins like mac1 may form different complexes depending on subcellular localization and cell cycle stage. Validation through multiple complementary techniques is strongly recommended.

What are the most effective strategies for generating mac1 knockout or modified strains?

Gene Deletion Approaches:
S. pombe is amenable to homology-directed DNA repair, making precise genome editing relatively straightforward. As noted in search result : "Schizosaccharomyces pombe is a widely used model organism to study many aspects of eukaryotic cell physiology. Its popularity as an experimental system partially stems from the ease of genetic manipulations, where the innate homology-targeted repair is exploited to precisely edit the genome" .

For mac1 deletion, consider:

  • Replacement cassette design:

    • 500-1000bp homology arms flanking mac1 ORF

    • Selection marker (e.g., ura4+, LEU2, kanMX6)

    • Verification primers outside the homology region

  • Transformation methods:

    • Lithium acetate transformation

    • Electroporation for higher efficiency

CRISPR-Cas9 Modification:
For precise editing without selection markers:

  • Design guide RNAs targeting mac1 (avoid transmembrane domains)

  • Co-transform with repair template containing desired modifications

  • Screen by colony PCR and sequencing

Conditional Alleles:
For essential genes or temporal control:

  • Degron-tagging strategies (auxin-inducible or temperature-sensitive)

  • Promoter replacement with regulatable promoters

When designing genetic modifications, researchers should consider potential impacts on the expression of neighboring genes. The methodological approach should follow established protocols for S. pombe, with appropriate controls to verify both the genetic modification and the resulting phenotypic changes.

How can researchers assess the functional consequences of mac1 modifications?

Phenotypic Analysis Framework:

  • Growth and viability assays:

    • Growth curves under various conditions

    • Colony formation efficiency

    • Cell morphology analysis

  • Membrane integrity and function:

    • Sensitivity to membrane-perturbing agents

    • Membrane potential measurements

    • Lipid composition analysis

  • Molecular phenotyping:

    • Transcriptomics to identify affected pathways

    • Proteomics to detect compensatory changes

    • Metabolomics for downstream effects

Control Strategy:
Always include:

  • Wild-type control

  • Complementation with wild-type mac1

  • Complementation with mutant versions

  • Vector-only control

The approach to functional analysis should be guided by hypotheses about mac1's role based on its sequence features, localization, and interaction partners. Researchers might draw parallels to other membrane proteins in S. pombe for which functional analysis methods have been established, while adapting these methods to address the specific characteristics of mac1.

How does mac1 function relate to cell wall integrity pathways in S. pombe?

The potential relationship between mac1 and cell wall integrity can be investigated using approaches similar to those described for the Mkh1 signaling pathway. Search result notes that "Mkh1, a MEK kinase in Schizosaccharomyces pombe that is required for cell wall integrity" and that deletion of pathway components results in "sensitivity to (beta)-glucanase treatment, growth inhibition on media containing KCl, and filamentous growth on medium containing caffeine" .

Experimental Approach:

  • Comparative phenotyping:

    • Test mac1Δ strains for sensitivity to cell wall stressors (beta-glucanase, calcofluor white)

    • Examine growth on high osmolarity media (KCl, sorbitol)

    • Test caffeine sensitivity for filamentous growth phenotypes

  • Genetic interaction analysis:

    • Create double mutants of mac1 with known cell wall integrity pathway components

    • Test for synthetic lethality or suppression

    • Perform high-throughput genetic interaction screens

  • Signaling pathway analysis:

    • Monitor MAPK activation states in mac1Δ backgrounds

    • Test for physical interactions with Mkh1-Skh1-Spm1 pathway components

This approach leverages established phenotypic signatures of cell wall integrity pathway defects to assess potential functional relationships with mac1, providing insights into its broader cellular roles.

What role might mac1 play in meiotic processes in S. pombe?

Several search results ( , ) discuss meiotic processes and recombination in S. pombe, suggesting approaches that could be adapted to study potential mac1 functions in meiosis.

Investigative Strategy:

  • Expression analysis:

    • Monitor mac1 expression during meiotic progression

    • Compare to known meiotic-specific genes like dmc1+, which "are co-transcribed as a bicistronic mRNA of 2.8 kb with meiotic specificity"

  • Meiotic phenotype analysis:

    • Spore viability assays in mac1Δ strains

    • Meiotic recombination frequency measurement

    • Chromosome segregation analysis

  • Molecular function investigation:

    • Chromatin immunoprecipitation during meiosis

    • Protein localization during meiotic phases

    • Interaction studies with known meiotic factors

Comparative Analysis Table:

ProcessWildtypemac1ΔTechniques
Meiotic progressionNormal timingTo be determinedDAPI staining time course
Spore formation4-spore asciTo be determinedTetrad dissection
Recombination frequencyBaselineTo be determinedGenetic markers as in
Chromosome segregationNormalTo be determinedFluorescent chromosome tags

By applying methodologies established for studying meiotic processes in S. pombe, researchers can determine whether mac1 plays significant roles in sexual reproduction and genetic recombination, expanding our understanding of this membrane protein's cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.