Recombinant Schizosaccharomyces pombe Methylene-fatty-acyl-phospholipid synthase (cho1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cho1; SPBC337.16; Phosphatidyl-N-methylethanolamine N-methyltransferase; Phospholipid methyltransferase; PLMT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cho1
Target Protein Sequence
MSLILYPKPTSYLYQPFIKAYFSLNMAIFEINNSFLICAVSIALNPLLWNIAARSEYNHK TLTKLANGDSKKACYMLAACIFVAGIVRDLIYQNALKQQPTLGIFMNPLVQGIAKLIFCF GSVLVLSSMYKLGLVGTYLGDYFGFLLPERVSGFPFNVNDNPMYNGSTLCFLSTALRYGK VAGLLLTLEVFFVYRIALKFEEPFTAKIYAARDSKQAKKSE
Uniprot No.

Target Background

Function
This enzyme catalyzes the final two steps in the phosphatidylcholine biosynthesis methylation pathway. Specifically, it mediates the SAM-dependent methylation of phosphatidylmonomethylethanolamine (PMME) to phosphatidyldimethylethanolamine (PDME), and subsequently, the methylation of PDME to phosphatidylcholine (PC).
Database Links
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Methylene-fatty-acyl-phospholipid synthase (cho1) and what is its role in phospholipid biosynthesis?

The cho1+ gene in Schizosaccharomyces pombe encodes a phospholipid methyltransferase enzyme that catalyzes a critical step in the synthesis of phosphatidylcholine (PC) via the methylation of phosphatidylethanolamine (PE). This enzyme represents the first structural gene encoding a phospholipid biosynthetic enzyme from S. pombe to be cloned and characterized. Sequence analysis reveals that the cho1+ gene product is closely related to phospholipid methyltransferases from other eukaryotes, including Saccharomyces cerevisiae and rat, suggesting evolutionary conservation of both structure and function across diverse organisms .

The enzyme plays an essential role in membrane biogenesis, as phosphatidylcholine is a major component of eukaryotic membranes. In S. pombe, disruption of the cho1+ gene (cho1Δ) results in choline auxotrophy, meaning the mutant cells require exogenous choline for viability and growth. The auxotrophy can be rescued by supplementing the growth medium with choline, which allows the cells to synthesize phosphatidylcholine through an alternative pathway .

How does the genetic organization of cho1+ compare to related genes in other organisms?

The cho1+ gene in S. pombe shows significant structural and functional homology to phospholipid methyltransferases from other organisms. Unlike some other biosynthetic pathways where gene organization differs substantially between species, the phospholipid methylation pathway demonstrates remarkable conservation. Complementation studies have shown that phospholipid methyltransferases encoded by a rat liver cDNA and the S. cerevisiae OPI3 gene can both functionally substitute for the S. pombe cho1+ gene, rescuing the choline auxotrophy of cho1 mutants .

This cross-species functionality provides compelling evidence that the fundamental mechanisms of phospholipid methylation have been preserved throughout eukaryotic evolution. For researchers, this conservation offers valuable opportunities for comparative studies and the potential to translate findings across model systems.

What are proven methods for tracking cho1-dependent phospholipid flux between organelles?

The METALIC (Mass tagging-Enabled TrAcking of Lipids In Cells) method represents a powerful approach for studying interorganelle lipid flux that could be applied to cho1-dependent pathways. This technique employs dual labeling strategies to track the movement of phospholipids between organelles in vivo. For studying cho1 activity specifically, researchers can adapt this method to monitor phosphatidylethanolamine to phosphatidylcholine conversion and subsequent trafficking between cellular compartments .

The methodology involves:

  • Introducing mass-labeled precursors (such as deuterated methionine as methyl group donor)

  • Tracking the incorporation of labeled groups into phospholipids

  • Monitoring the appearance of labeled phospholipids in different cellular compartments over time

  • Quantifying double-labeled species as indicators of interorganelle transport

In validation experiments with other lipid metabolism pathways, researchers observed the fraction of double-labeled lipids increasing over time, indicating ongoing lipid transport between organelles. Control experiments using deletion mutants of transport proteins demonstrated the specificity of the labeling patterns, confirming the approach's reliability for studying organelle-specific lipid metabolism .

How can researchers generate and characterize cho1 mutants in S. pombe?

To generate cho1 mutants in S. pombe, researchers have successfully employed several complementary approaches:

Chemical Mutagenesis:
Chemical mutagens such as N-methyl-N'-nitro-N-nitrosoguanidine (MNNG) or ethyl methanesulfonate (EMS) can be used to generate random mutations in the S. pombe genome. Mutants are then screened for choline auxotrophy and further characterized by complementation testing to identify those affecting the cho1+ gene .

Gene Disruption:
Targeted disruption of cho1+ can be achieved through homologous recombination. This approach involves:

  • Constructing a disruption cassette containing a selectable marker flanked by cho1+ homologous sequences

  • Transforming the cassette into S. pombe cells

  • Selecting for marker expression and confirming disruption through PCR and Southern blot analysis

  • Verifying the phenotype by testing growth with and without choline supplementation

Complementation Analysis:
To confirm that observed phenotypes result from cho1 mutations, complementation tests should be performed by:

  • Transforming mutant strains with plasmids carrying the wild-type cho1+ gene

  • Assessing rescue of choline auxotrophy

  • Testing cross-complementation with related genes from other organisms (e.g., S. cerevisiae OPI3)

What assays are available for measuring cho1 enzyme activity in vitro and in vivo?

In Vitro Enzymatic Assays:

For quantitative measurement of cho1 methyltransferase activity, researchers can employ radiometric assays using S-adenosyl-[methyl-³H]methionine (SAM) as the methyl donor:

  • Prepare reaction mixtures containing:

    • Purified recombinant cho1 enzyme or cell extracts

    • Phosphatidylethanolamine substrate

    • Radiolabeled SAM

    • Appropriate buffer system (typically pH 7.0-8.0)

  • Incubate reactions at 30°C (optimal for S. pombe proteins)

  • Extract lipids using chloroform/methanol (2:1, v/v)

  • Separate phospholipids by thin-layer chromatography

  • Quantify incorporated radioactivity using scintillation counting

In Vivo Phospholipid Analysis:

To track cho1-dependent phospholipid metabolism in living cells, researchers can use:

  • Metabolic Labeling: Incorporate deuterated methionine into cells, allowing tracking of methylation events over time .

  • Lipid Mass Spectrometry: Extract cellular lipids and analyze phospholipid profiles by LC-MS/MS to determine the relative abundance of phosphatidylethanolamine, phosphatidylmonomethylethanolamine, phosphatidyldimethylethanolamine, and phosphatidylcholine.

  • Growth Complementation: Assess cho1 activity by measuring the ability of mutant or modified cho1 constructs to rescue the growth of cho1Δ strains in the absence of choline .

How does cho1 activity impact membrane dynamics and interorganelle contacts in S. pombe?

The cho1-mediated phospholipid methylation pathway plays a critical role in membrane dynamics and interorganelle contacts through its contribution to phosphatidylcholine biosynthesis. Phosphatidylcholine, with its cylindrical molecular shape and specific biophysical properties, affects membrane curvature, fluidity, and the formation of membrane contact sites between organelles.

Research using techniques like METALIC (Mass tagging-Enabled TrAcking of Lipids In Cells) has demonstrated that phospholipids synthesized in one organelle can be transported to other compartments, with specific protein complexes mediating this interorganelle exchange . For cho1-dependent phospholipids, this transport is particularly relevant at ER-mitochondria contact sites.

Studies examining ER-mitochondria lipid exchange show that protein complexes like ERMES (ER-Mitochondria Encounter Structure) and the Vps13-Mcp1 system facilitate phospholipid transport. When monitoring double mass-labeled phospholipid species (indicative of interorganelle transport), researchers observed that co-inactivation of ERMES and either Vps13 or Mcp1 reduced the transport of certain phospholipid species to nearly background levels, particularly for PC 32:1 .

This suggests that cho1-produced phospholipids rely on these transport complexes for proper distribution throughout the cell. Disruption of cho1 activity would likely alter the composition of these membrane contact sites and potentially disrupt critical cellular processes dependent on proper phospholipid distribution.

What is the evolutionary relationship between S. pombe cho1 and related enzymes in other organisms?

The evolutionary conservation of phospholipid methyltransferases across eukaryotes provides important insights into membrane biogenesis throughout evolution. Sequence analysis of the S. pombe cho1+ gene reveals significant homology with phospholipid methyltransferases from other organisms including Saccharomyces cerevisiae and mammals.

The functional conservation is particularly striking, as demonstrated by cross-species complementation experiments. Both the rat liver phospholipid methyltransferase cDNA and the S. cerevisiae OPI3 gene can functionally replace the S. pombe cho1+ gene, rescuing the choline auxotrophy phenotype of cho1 mutants . This cross-species functionality indicates that despite approximately 1 billion years of evolutionary divergence between fungi and mammals, the core catalytic mechanism and substrate recognition features of these enzymes have been preserved.

The table below summarizes key evolutionary features of phospholipid methyltransferases across different organisms:

OrganismGene NameComplementation of S. pombe cho1 mutantsSubstrate SpecificityKey Structural Features
S. pombecho1+N/A (reference gene)PE → PC via sequential methylationConserved SAM-binding domain
S. cerevisiaeOPI3YesPrimarily PE → PMME → PDME → PCSimilar domain organization to S. pombe cho1
Rat liverPEMTYesSimilar to fungal enzymesMembrane-associated, conserved catalytic residues
HumansPEMTPredicted functionalityPE → PCMultiple isoforms with tissue-specific expression

This evolutionary conservation makes the S. pombe cho1 system an excellent model for understanding fundamental aspects of eukaryotic membrane biogenesis that may apply to higher organisms including humans.

How can researchers address inconsistent results when measuring cho1 activity in different experimental conditions?

Inconsistent results when measuring cho1 activity can stem from multiple factors. Researchers should systematically address the following potential issues:

Enzyme Stability Considerations:
Phospholipid methyltransferases are membrane-associated enzymes that may exhibit context-dependent activity. The temporal stability of measurements is a critical factor to consider. For instance, in some lipid labeling experiments, the t3.5 timepoint has been observed to be unusually discrepant, likely due to cellular adaptation to sudden changes in substrate availability (e.g., methionine concentration increases) . Allow sufficient adaptation periods when dramatically changing substrate concentrations.

Substrate Presentation and Accessibility:
The physical state of phospholipid substrates significantly impacts enzyme activity. For in vitro assays, test different substrate presentations:

  • Liposomes of varying composition

  • Mixed micelles with detergents (e.g., Triton X-100)

  • Substrate incorporated into native membrane preparations

Cofactor Availability and Transport:
For in vivo experiments, consider the availability of S-adenosylmethionine (SAM), the methyl donor for cho1 activity. Research has shown that transport of SAM across membranes can be rate-limiting. For example, deletion of the sam5 gene, which encodes the major transporter of SAM across the inner mitochondrial membrane, severely impairs methylation reactions within mitochondria . Consider measuring cellular SAM levels and potentially supplementing with SAM precursors.

Standardization Recommendations:

  • Include appropriate controls in each experiment (wild-type, known inactive mutants)

  • Normalize activity to protein concentration determined by consistent methods

  • Use internal standards for mass spectrometry analyses

  • Establish time-course measurements to capture enzyme kinetics rather than single timepoints

What are the critical parameters for successful expression and purification of recombinant cho1 enzyme?

Expression System Selection:
The choice of expression system significantly impacts the yield and activity of recombinant cho1. Consider these options with their respective advantages:

  • E. coli expression: While offering high yield, membrane proteins often misfold or form inclusion bodies. If using E. coli:

    • Utilize specialized strains designed for membrane proteins (C41/C43)

    • Express as fusion with solubility-enhancing tags (MBP, SUMO)

    • Employ lower induction temperatures (16-20°C)

  • Yeast expression (S. cerevisiae or P. pastoris):

    • Provides eukaryotic folding machinery

    • Contains appropriate lipid environment

    • Allows for secretion or microsomal preparation

    • Consider using inducible promoters (GAL1 for S. cerevisiae, AOX1 for P. pastoris)

  • S. pombe expression (homologous):

    • Ensures native folding environment

    • Can utilize the endogenous promoter or the inducible urg1 promoter system, which allows rapid induction within 30 minutes

    • Offers advantage over the traditional nmt1 promoter that requires 14-20 hours for full induction

Purification Strategy:
The membrane-associated nature of cho1 presents unique purification challenges:

  • Membrane preparation:

    • Optimize cell lysis conditions (enzymatic vs. mechanical disruption)

    • Fractionate cellular components by differential centrifugation

    • Prepare microsomes for enrichment of ER-associated cho1

  • Detergent selection:

    • Screen multiple detergents (DDM, CHAPS, digitonin) for optimal extraction

    • Consider detergent concentration effects on enzyme activity

    • Test detergent-lipid mixed micelles to maintain native-like environment

  • Affinity purification:

    • Incorporate epitope tags that minimally impact activity (His6, FLAG)

    • Position tags at N- or C-terminus based on topology predictions

    • Include protease inhibitors throughout the purification process

Activity Preservation:
To maintain cho1 activity post-purification:

  • Supplement buffers with glycerol (10-20%) to enhance stability

  • Include reducing agents (DTT or β-mercaptoethanol) to protect cysteine residues

  • Consider reconstitution into liposomes or nanodiscs for long-term storage

  • Perform activity assays immediately after purification to establish baseline activity

How can cho1 be applied in synthetic biology and lipid engineering approaches?

The cho1+ enzyme offers significant potential for synthetic biology applications focused on membrane engineering and lipid production. By manipulating phospholipid composition through controlled expression of cho1 and related enzymes, researchers can:

  • Engineer membrane properties in yeast:
    Controlling the ratio of phosphatidylethanolamine to phosphatidylcholine allows fine-tuning of membrane curvature, fluidity, and permeability. This has applications in creating yeast strains with enhanced tolerance to industrial conditions or improved transport capabilities.

  • Develop lipid production platforms:
    Researchers can engineer S. pombe strains with modified cho1 expression to produce specific phospholipid profiles for biotechnological applications. The incorporation of cyclopropane fatty acids into phospholipids, as demonstrated in the METALIC approach, provides additional opportunities for creating lipids with novel properties .

  • Create biosensors for phospholipid dynamics:
    By fusing fluorescent proteins to domains that specifically recognize cho1 products, researchers could develop real-time sensors for monitoring phospholipid metabolism in living cells. Such tools would be valuable for studying the effects of drugs targeting lipid metabolism.

The established genetic tractability of S. pombe makes it an excellent platform for these applications. The ability to induce gene expression rapidly using systems like the urg1 promoter (achieving full induction within 30 minutes compared to the 14-20 hours required for the traditional nmt1 promoter) provides precise temporal control for synthetic biology applications .

What is the relationship between cho1 activity and telomere maintenance in S. pombe?

While direct evidence linking cho1 activity to telomere maintenance is limited, there are intriguing connections between membrane lipid composition and telomere biology in S. pombe that warrant investigation. The telomeric shelterin complex, which caps chromosome ends and plays crucial roles in telomere maintenance and protection, relies on proper association with cellular membranes during certain phases of the cell cycle .

In S. pombe, the shelterin complex consists of telomeric single- and double-stranded DNA-binding protein subcomplexes Pot1-Tpz1 and Taz1-Rap1, which are bridged by the interacting protein Poz1 . Proper interactions between these components are essential for telomere length homeostasis and heterochromatin structure maintenance at telomeres.

The potential relationship between cho1 activity and telomere maintenance could be investigated through several approaches:

  • Membrane association studies:
    Determine whether components of the shelterin complex associate with specific membrane domains that are dependent on cho1-produced phospholipids.

  • Telomere length analysis in cho1 mutants:
    Measure telomere length in cho1+ mutants grown under different conditions (with/without choline supplementation) to assess whether altered phospholipid composition affects telomere homeostasis.

  • Phospholipid composition at the nuclear envelope:
    Analyze whether cho1-dependent phospholipids are enriched at the nuclear envelope and particularly at sites of telomere attachment.

Research into these connections could reveal novel roles for membrane lipids in genome stability and chromosome organization, potentially identifying new therapeutic targets for diseases associated with telomere dysfunction.

What is the optimal protocol for measuring interorganelle phospholipid transport involving cho1-generated lipids?

METALIC Protocol for Tracking Cho1-Generated Phospholipids:

The METALIC (Mass tagging-Enabled TrAcking of Lipids In Cells) method provides a powerful approach for tracking interorganelle phospholipid transport involving cho1-generated lipids. This protocol has been validated for studying ER-mitochondria lipid exchange and can be adapted specifically for cho1-produced phospholipids .

Materials Required:

  • Deuterated methionine (d-methionine)

  • Cyclopropane fatty acid synthase (CFAse) expression construct

  • S. pombe strains (wild-type and relevant mutants)

  • Lipid extraction reagents (chloroform, methanol)

  • LC-MS/MS system

Procedure:

  • Strain Preparation:

    • Transform S. pombe with constructs expressing organelle-targeted CFAse

    • For ER-targeted expression, use appropriate ER retention signals

    • For mitochondrial targeting, use mitochondrial localization sequences

    • Verify localization using fluorescent protein fusions

  • Dual Labeling:

    • Grow cells to mid-log phase in standard medium

    • Replace medium with one containing d-methionine (tenfold higher than normal concentration)

    • Take samples at specific timepoints (0, 1.5, 3.5, 5.5, and 8 hours post-labeling)

  • Lipid Extraction and Analysis:

    • Harvest cells and extract total lipids using chloroform/methanol (2:1, v/v)

    • Separate phospholipid classes by solid-phase extraction

    • Analyze samples by LC-MS/MS, looking specifically for:

      • Lipids with deuterated headgroups (+3 Da shift)

      • Lipids with cyclopropane modifications (+14 Da shift)

      • Double-labeled lipids (+17 Da shift)

  • Data Analysis:

    • Calculate the fractions of each labeled population over time

    • Plot the kinetics of appearance of double-labeled species

    • Compare results between wild-type and mutant strains

Controls and Validation:

  • Include sam5Δ mutants as negative controls (defective in SAM transport)

  • Include strains with disrupted membrane contact sites (e.g., ERMES components)

  • Verify labeling specificity using subcellular fractionation

Optimization Notes:

  • The t3.5 timepoint often shows discrepancies due to cellular adaptation to high methionine levels; consider additional timepoints around this period

  • Ensure consistent growth conditions across experiments to minimize variability

  • For cho1-specific studies, include cho1 mutants complemented with wild-type or mutant versions of the gene

This protocol allows precise quantification of interorganelle phospholipid transport with temporal resolution, providing insights into the dynamics of cho1-generated phospholipids throughout the cell.

How can genomic integration approaches be used to study cho1 function in S. pombe?

S. pombe offers versatile genomic integration approaches for studying cho1 function, allowing precise manipulation of the endogenous locus while maintaining native regulation or introducing controlled modifications.

Site-Directed Mutagenesis via Homologous Recombination:

  • Design Strategy:

    • Create a targeting construct containing:

      • Homology arms (500-1000 bp) flanking the cho1+ locus

      • Mutated cho1 sequence with desired modifications

      • Selectable marker (e.g., ura4+, kanMX6)

      • Consider flanking the marker with loxP sites for later removal

  • Transformation Protocol:

    • Prepare competent S. pombe cells using lithium acetate method

    • Transform with linearized targeting construct

    • Select transformants on appropriate medium

    • Confirm integration by PCR and sequencing

  • Marker Removal (Optional):

    • Transform confirmed integrants with a Cre recombinase expression plasmid

    • Induce Cre expression to excise the marker between loxP sites

    • Screen for marker loss

    • Verify clean excision by sequencing

Regulatable Expression Systems:

The traditional nmt1 promoter system requires 14-20 hours for full induction, which may be suboptimal for studying dynamic processes. Instead, consider the urg1 promoter system, which allows rapid induction within 30 minutes, similar to the GAL induction system in S. cerevisiae .

  • urg1 Promoter Integration:

    • Design a construct placing cho1+ under urg1 promoter control

    • Include appropriate 5' and 3' UTR regions

    • Integrate at the endogenous cho1 locus or at a neutral site

    • Confirm proper regulation by Northern blot or RT-qPCR

  • Induction Protocol:

    • Grow cells to mid-log phase

    • Add uracil to the medium (inducer for urg1 promoter)

    • Monitor cho1 expression and subsequent phospholipid changes

Fluorescent Tagging for Localization Studies:

  • C-terminal Tagging:

    • Design a construct with GFP or other fluorescent protein

    • Include a flexible linker between cho1 and the tag

    • Target integration to create an in-frame fusion

    • Verify functionality by complementation testing

  • Localization Analysis:

    • Counterstain with organelle markers

    • Perform live-cell imaging

    • Consider time-lapse microscopy to track dynamic changes

Validation Approaches:

  • Functional Complementation:

    • Test whether modified cho1 versions rescue cho1Δ choline auxotrophy

    • Quantify growth rates in media with/without choline

    • Analyze phospholipid profiles to confirm pathway restoration

  • Protein Expression Verification:

    • Perform Western blotting with anti-cho1 antibodies or tag-specific antibodies

    • Quantify expression levels relative to wild-type

These genomic integration approaches provide powerful tools for dissecting cho1 function while maintaining physiologically relevant expression patterns and avoiding artifacts associated with plasmid-based overexpression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.