Recombinant Schizosaccharomyces pombe Methylsterol monooxygenase (erg25)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization

ERG25 is a membrane-bound, non-heme iron-dependent oxygenase. Key features include:

  • Catalytic Function: Converts 4,4-dimethylzymosterol to 4-methylzymosterol by oxidizing the C-4 methyl group, initiating C-4 demethylation in the ergosterol biosynthesis pathway .

  • Structural Motifs:

    • C-terminal ER Retrieval Signal (KKXX): Ensures localization to the endoplasmic reticulum (ER) .

    • Histidine-Rich Clusters (HX₃H, HX₂HH, HX₂HH): Essential for iron coordination and catalytic activity .

Table 2: Key Enzymes in C-4 Demethylation

EnzymeFunctionOrganism
ERG25C-4 methyl oxidaseS. pombe
ERG26Sterol-4α-carboxylate dehydrogenaseS. pombe
ERG273-Keto-steroid reductaseS. pombe
MSMO1Human C-4 methyl sterol oxidaseHomo sapiens

Post-Translational Regulation

ERG25 stability is dynamically regulated via the ER-associated degradation (ERAD) pathway:

  • Ubiquitination: Polyubiquitinated ERG25 is recognized by the proteasome for degradation .

  • Regulatory Factors:

    • ERAD E3 Ligases: Ubc7 and Hrd1 mediate ERG25 ubiquitination .

    • Sterol Levels: Low sterol triggers ERG25 stabilization, ensuring adequate ergosterol synthesis .

Table 3: ERG25 Degradation Pathway Components

ComponentRoleReference
Ubc7E2 ubiquitin-conjugating enzyme
Hrd1E3 ubiquitin ligase
ProteasomeDegrades polyubiquitinated ERG25

Biotechnological Production

Recombinant ERG25 is used to study sterol metabolism and optimize ergosterol biosynthesis:

  • Heterologous Expression: E. coli-produced His-tagged ERG25 enables purification and structural studies .

  • Membrane Protein Analysis: ER localization and membrane integration are critical for function .

Mechanistic Studies

  • Iron Dependency: Histidine clusters coordinate iron, enabling oxygenase activity .

  • Structural Homology: Alphafold predictions reveal conserved motifs with human MSMO1 and S. cerevisiae ERG25 .

Comparative Analysis with Homologs

Table 4: ERG25 Homologs Across Species

OrganismGene/ProteinFunctionReference
S. pombeERG25 (Q9UUH4)C-4 methyl oxidase
S. cerevisiaeERG25 (NP_011574.3)C-4 methyl oxidase
H. sapiensMSMO1 (O75534)C-4 methyl sterol oxidase
Arabidopsis thalianaSMO2-1 (NP_563789.1)C-4 methyl oxidase

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If a specific tag type is required, please inform us; we will prioritize its incorporation.
The tag type will be determined during the production process. If you require a specific tag, please specify it for preferential development.
Synonyms
erg25; SPAC630.08c; Methylsterol monooxygenase; C-4 methylsterol oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erg25
Target Protein Sequence
MNTTSEVIVGTGFQAIRQQLAQMHPELNFVEQLWLAYYKWFDNDVVATGLMSFLLHELIY FGRCIPWMIIDAMPYFRRWKIQPKKVPTLAEQWECTRLVLLSHFTVELPQIWLFDPMCAT FGLSTSVPFPPVTKMIWQITLFFFLEDTWHYWAHRLFHYGIFYRFIHKVHHRYSAPFGLS AEYAHPLEIILLGAGTVFVPLMWCYFTHDLHLVTMYIWITLRLFQAVDSHAGYDFPWSLN KFLPIWAGADHHDYHHMAFKDNFSSSFRWWDAVLKTDQNYHQFKARRLAAKYEAESKKAK
Uniprot No.

Target Background

Function
This enzyme catalyzes the initial step in the removal of the two C-4 methyl groups from 4,4-dimethylzymosterol.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Methylsterol monooxygenase (erg25)?

Schizosaccharomyces pombe Methylsterol monooxygenase (erg25) is a critical enzyme in the ergosterol biosynthesis pathway. It is classified as EC 1.14.13.72 and alternatively known as C-4 methylsterol oxidase. This enzyme catalyzes the oxidative removal of methyl groups at the C-4 position of sterols, an essential step in producing functional membrane sterols in fungi . The gene is identified as erg25 with the ORF name SPAC630.08c. The protein consists of 300 amino acids and contains three conserved histidine-rich motifs (HX3H, HX2HH, and HX2HH) that are characteristic of membrane-bound non-haem iron oxygenases involved in lipid oxidation .

What is the functional significance of methyl group removal in sterol biosynthesis?

The removal of methyl groups from sterols is a crucial step in ergosterol biosynthesis, as it shapes the sterol molecule to optimize membrane properties. Research demonstrates that the successive carbon removals at C14 and C4 positions progressively alter the sterol structure to achieve optimal membrane microviscosity and support proper cell growth . Studies comparing membranes containing 4,4-dimethylsterols, 4-methylsterols, and fully processed sterols (like cholesterol) show a gradual increase in membrane microviscosity with each methyl group removal . This progressive modification of sterol structure is evolutionarily significant, as 4-methylsterols have been identified in ancestral organisms, suggesting a stepwise refinement of sterol structures through evolution .

How does S. pombe erg25 compare structurally to homologs in other species?

S. pombe erg25 shares conserved functional domains with its homologs in other fungi, though with notable evolutionary divergence:

SpeciesProtein NameUniProt IDNotable Features
Schizosaccharomyces pombeerg25NP_592903.1300 amino acids, Three histidine-rich motifs
Saccharomyces cerevisiaeERG25NP_011574.3309 amino acids, Similar catalytic domains
Candida albicansErg25-Multiple genes (erg25 and erg251) working in tandem
Aspergillus fumigatusErg25A/B-Two functional paralogs with different roles

Unlike S. cerevisiae which primarily utilizes a single ERG25 gene, some fungi like Candida albicans and Aspergillus fumigatus employ two SMOs that work in tandem or serve distinct but complementary functions . This contrasts with plant systems, where separate SMO enzymes remove each of the two methyl groups at C4 . These evolutionary differences reflect adaptation to different membrane sterol requirements and metabolic contexts.

What are the optimal conditions for expressing recombinant S. pombe erg25?

For heterologous expression of S. pombe erg25, E. coli expression systems (particularly BL21(DE3)) have proven effective . Based on comparable studies with similar monooxygenases:

Expression optimization protocol:

  • Transform the erg25 gene into E. coli BL21(DE3) cells using a vector containing a histidine tag

  • Culture transformed cells at 37°C until reaching OD600 of 0.6-0.8

  • Induce protein expression with IPTG (0.1-0.5 mM) at 30°C for 4-6 hours or 16-18°C overnight

  • Harvest cells by centrifugation (6,000 x g, 15 minutes at 4°C)

  • Lyse cells using sonication in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol

  • Clarify the lysate by centrifugation (15,000 x g, 30 minutes at 4°C)

The optimal temperature for enzymatic activity of recombinant S. pombe flavin-containing monooxygenases was found to be 30°C at pH 8.0, with activity reaching 72.77 U/g under these conditions . Supplementation with Mg²⁺ was shown to enhance enzyme activity .

How can activity of recombinant S. pombe erg25 be assayed?

Enzymatic activity measurement protocol:

  • Substrate preparation: Prepare sterol substrates (such as 4,4-dimethyl sterols) in a suitable solvent system (typically containing detergents like Triton X-100)

  • Reaction mixture: Combine purified enzyme (1-5 μg) with 50-100 μM substrate in 100 mM phosphate buffer (pH 8.0) containing 1 mM NADPH and potentially 5 mM Mg²⁺

  • Incubation: Incubate the reaction at 30°C for 30-60 minutes

  • Analysis methods:

    • HPLC separation of sterols following extraction

    • GC-MS analysis after derivatization

    • Monitoring NADPH consumption at 340 nm spectrophotometrically

Enzyme kinetic analysis of similar S. pombe monooxygenases showed Km values of 23.89 μmol/L and kcat/Km of 61.71 L/(min·mmol) on their respective substrates . When designing such assays, researchers should consider the possible presence of endogenous sterols and optimize extraction methods accordingly.

How can S. pombe erg25 be utilized as a model for studying sterol metabolism disorders?

S. pombe erg25 provides an excellent model for studying disorders related to sterol metabolism, particularly because:

  • Conserved mechanisms: The key structural motifs and catalytic mechanisms of erg25 are conserved from fungi to humans, making it valuable for studying human sterol disorders

  • Experimental tractability: S. pombe is genetically manipulable and grows rapidly

  • Disease relevance: Mutations in human sterol C4-methyl oxidase can cause rare disorders including psoriasiform dermatitis, microcephaly, and developmental delay

Researchers can use the following approaches:

  • Generate point mutations in S. pombe erg25 that mimic human disease variants

  • Analyze the biochemical consequences through lipidomic profiling

  • Study the cellular impacts on membrane properties and stress responses

  • Perform complementation studies with human SMO genes to validate functional conservation

Studies in plants have shown that defects in SMO2 genes can cause embryonic lethality and developmental defects, indicating the critical importance of proper C4-demethylation in multicellular eukaryotes .

What is the relationship between S. pombe erg25 and antifungal drug mechanisms?

Ergosterol biosynthesis enzymes, including erg25, are prime targets for antifungal drugs. Research findings indicate:

  • The ergosterol pathway and particularly C4-demethylation is essential for fungal viability and stress response

  • In Aspergillus fumigatus, erg25 deletion mutants showed moderate susceptibility to hypoxia and endoplasmic reticulum stress (induced by DTT)

  • The transcription factor SrbA regulates ergosterol biosynthesis genes including erg25, and its deletion causes accumulation of C4-methyl sterols and heightened sensitivity to antifungals

Methodological approaches for studying erg25 in antifungal contexts:

  • Generate conditional knockdown mutants using regulatable promoters

  • Perform antifungal susceptibility testing under various stress conditions

  • Use lipidomic analysis to profile sterol intermediates accumulating during drug treatment

  • Implement compensatory expression of erg25 to assess rescue of drug susceptibility phenotypes

Research has shown that expression of erg25A partially restored the hypoxia growth defect of SrbA deletion mutants in Aspergillus fumigatus, suggesting a key role for C4-demethylation in hypoxic adaptation .

How do dual SMO systems in fungi differ functionally from the single S. pombe erg25?

Several fungal species employ multiple SMO enzymes, unlike S. pombe which utilizes a single erg25. Research reveals interesting functional distinctions:

OrganismSMO SystemFunctional Characteristics
S. pombeSingle erg25One enzyme catalyzes all C4-demethylation steps
A. fumigatusDual (Erg25A, Erg25B)Erg25A is primary (accumulates more C4-methyl sterols when deleted); Erg25B is secondary
C. albicansDual (Erg25, Erg251)Both essential, work in tandem; deletion of either is lethal
PlantsDual (SMO1, SMO2)Each removes one of two methyl groups in sequence

In Aspergillus fumigatus, deletion of erg25A resulted in greater accumulation of C4-methyl sterols than deletion of erg25B, indicating Erg25A functions as the predominant SMO . The presence of two functional SMOs may represent an evolutionary adaptation to ensure robust sterol biosynthesis, as attempts to generate double deletion mutants in A. fumigatus proved unsuccessful, suggesting lethality .

Methodologically, researchers comparing SMO systems should:

  • Generate single and conditional double mutants

  • Perform detailed sterol profiling to identify specific accumulated intermediates

  • Analyze growth under various stress conditions

  • Conduct enzyme kinetic studies on purified recombinant proteins with various sterol substrates

What are the key considerations for designing in vitro S. pombe erg25 activity assays?

When designing in vitro assays for S. pombe erg25 activity, researchers should consider:

  • Enzyme preparation:

    • Use freshly purified enzyme or store with 50% glycerol at -20°C

    • Avoid repeated freeze-thaw cycles, which reduce activity

    • Working aliquots can be stored at 4°C for up to one week

  • Substrate considerations:

    • Natural sterol substrates are hydrophobic and require proper solubilization

    • Consider using detergents (0.1-0.5% Triton X-100) or cyclodextrins to solubilize sterols

    • Ensure substrate concentration is optimized (typical range: 10-100 μM)

  • Cofactor requirements:

    • Include NADPH as an essential cofactor

    • Add FAD/FMN as flavin-dependent monooxygenases often require flavin cofactors

    • Consider adding 5 mM Mg²⁺ which has been shown to improve enzyme activity of similar S. pombe monooxygenases

  • Controls:

    • Include heat-inactivated enzyme controls

    • Run parallel assays with known substrates from related enzymes

    • Include inhibitor controls when relevant

Studies with similar S. pombe monooxygenases achieved reaction yields of 12.31% within 9 hours under optimal conditions , providing a benchmark for expected enzymatic performance.

How can researchers distinguish between the roles of different methyl oxidases in complex systems?

To distinguish between the roles of different methyl oxidases in systems with multiple enzymes:

  • Genetic approaches:

    • Generate single and conditional double knockout strains

    • Create chimeric proteins swapping domains between different SMOs

    • Use CRISPR-Cas9 to introduce specific mutations in conserved catalytic domains

  • Biochemical approaches:

    • Perform detailed sterol profiling using GC-MS or LC-MS/MS

    • Look for specific accumulated intermediates as signatures of particular enzyme deficiencies

    • Conduct enzyme kinetic studies with purified enzymes on various substrates

  • Analytical tools:

    • Use advanced lipidomics to profile the complete sterol landscape

    • Implement isotope labeling to track the fate of specific sterols

    • Employ in silico modeling based on substrate docking studies

Research in Aspergillus fumigatus demonstrated that Erg25A functions as the predominant SMO, with deletion of erg25A resulting in greater accumulation of C4-methyl sterols than deletion of erg25B . This approach of comparing accumulated intermediates provides a powerful method for distinguishing the roles of different enzymes in the same pathway.

What are emerging applications for recombinant S. pombe erg25 in biotechnology?

Emerging applications for recombinant S. pombe erg25 include:

  • Biocatalytic sterol modification:

    • Using erg25 for enzymatic synthesis of specialized sterols

    • Similar monooxygenases from S. pombe have been successfully used to synthesize S-methyl-L-cysteine sulfoxide (SMCO) with yields of 12.31% within 9 hours

  • Antifungal drug development:

    • High-throughput screening platforms using recombinant erg25

    • Structure-based design of selective inhibitors targeting pathogen-specific features

  • Membrane engineering:

    • Modifying sterol composition to alter membrane properties

    • Creating yeast strains with novel membrane characteristics for industrial applications

  • Biosensors for sterol pathway intermediates:

    • Developing erg25-based detection systems for sterol metabolism disorders

    • Creating diagnostic tools for fungal infections

Methodologically, researchers exploring these applications should focus on optimizing enzyme stability, improving catalytic efficiency, and developing immobilization techniques for industrial applications.

How might environmental factors affect S. pombe erg25 function and regulation?

Research on similar sterol metabolic enzymes indicates that environmental factors significantly impact erg25 function and regulation:

  • Oxygen availability:

    • Erg25 requires oxygen as a substrate for its monooxygenase activity

    • Hypoxic conditions affect erg25 expression and activity

    • The transcription factor SrbA regulates erg25 expression in response to hypoxia

  • Temperature effects:

    • Temperature impacts membrane fluidity and consequently sterol requirements

    • Similar to findings in Methylococcus capsulatus, yeast may modulate sterol content in response to temperature changes

    • Optimal temperature for enzymatic activity of related S. pombe monooxygenases is 30°C

  • Metal ion availability:

    • As a non-haem iron enzyme, erg25 function depends on iron availability

    • Mg²⁺ supplementation improves activity of related monooxygenases

    • Metal ion homeostasis pathways likely coordinate with sterol metabolism

  • Stress response integration:

    • Endoplasmic reticulum stress affects erg25 function

    • Deletion of erg25A in A. fumigatus showed moderate susceptibility to the ER stress-inducing agent DTT

Researchers should design experiments that systematically vary these environmental parameters to fully understand their impact on erg25 regulation and function in S. pombe.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.