Recombinant Schizosaccharomyces pombe Mitochondrial distribution and morphology protein 31 (mdm31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mdm31; SPAC3H1.04c; Mitochondrial distribution and morphology protein 31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
67-601
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mdm31
Target Protein Sequence
RTTPVIIKQISMVRSYSSGDVENPEILNKNESNQSSGVKRAMPFRVLKKMKSFLFKQNKP LTVDNVTAFFSWWLVSHIVWIVVGTTTFFSLLLYTLNTVSAQELLGRWIGQLMTKNTGFQ FVFESAIVPNWRKGLITFNKISVIRRPDTLNGIGAQNPNNKSDYEKEYMALRKRYDSNEE PDTEALSQGNYTQFELSIDKADVSFSFARFLNGKGIVKELQLKGVRGVVDRRFIEWDPSS DPRDYRRKHNWGDFEIEKFKLEDLRVTLLQPKGFRKFPVSVFFCELPRLRKQWLFYDLMN AKTLTGSFDNSMFTIHRLQLRPYSPYLKVGKQLDDMRHSRLRIDNVAIDHLNRGVSGAFG WINDGSVDFLVNISFPSEPSENSFQKAWISLMDKLKKKEKDEDVYKDVHFDVNVQLHNPK AVIPIFTNQVSYINNALIRPIIAYINSTRTFIPILCHVSKPLSDFDGSWTFYDSGVLQEI SAQVYESFARDVLNQEIRRKRIQKVGYWSLRRFLHLVLVSLQELAPTTSSISNFE
Uniprot No.

Target Background

Function

Mdm31 is involved in the organization of mitochondrial membranes and the overall mitochondrial structure. It is also essential for mitochondrial distribution, mobility, and the maintenance of mitochondrial DNA nucleoid structures.

Gene References Into Functions
  1. Mdm31 protein mediates sensitivity to potassium ionophores but does not regulate mitochondrial morphology or phospholipid trafficking. PMID: 25483891
Database Links
Protein Families
MDM31/MDM32 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Mdm31 and what is its primary function in S. pombe?

Mdm31 is a mitochondrial inner membrane protein encoded by the mdm31 gene (ORF name: SPAC3H1.04c) in Schizosaccharomyces pombe. Based on studies in related yeasts, Mdm31 is essential for maintaining proper mitochondrial morphology, distribution, and function . The protein plays a critical role in the organization of mitochondrial DNA (mtDNA) nucleoids and is involved in the stability of the mitochondrial genome . While most detailed functional studies have been conducted in S. cerevisiae, the conservation of this protein across yeast species suggests similar fundamental roles in S. pombe, though species-specific variations may exist .

What are the primary research applications for recombinant S. pombe Mdm31 protein?

Recombinant S. pombe Mdm31 protein serves as a valuable tool in several research contexts:

  • Structural and functional studies: The purified protein can be used for in vitro interaction studies to determine binding partners and functional domains.

  • Antibody production and validation: Recombinant Mdm31 can be used to generate and validate antibodies for immunodetection in various assays.

  • Protein interaction studies: Pull-down assays, co-immunoprecipitation, and yeast two-hybrid screens can utilize recombinant Mdm31 to identify novel interaction partners.

  • Comparative studies: The recombinant protein facilitates comparisons between Mdm31 from S. pombe and homologs from other species such as S. cerevisiae to investigate evolutionary conservation and divergence .

  • ELISA-based detection and quantification: The recombinant protein can serve as a standard for developing quantitative assays for Mdm31 detection in experimental samples .

What methods are recommended for expression and purification of recombinant S. pombe Mdm31?

For optimal expression and purification of recombinant S. pombe Mdm31:

How does S. pombe Mdm31 compare functionally to its S. cerevisiae homolog?

While both proteins share functional similarities, important differences exist:

FeatureS. pombe Mdm31S. cerevisiae Mdm31
Complex formationPrecise complex size unknown in S. pombeForms a distinct complex of ~600 kDa
Genetic interactionsLimited data on genetic interactions in S. pombeSynthetic lethal interactions with MMM1, MMM2, MDM10, and MDM12
mtDNA organizationRole in S. pombe mtDNA organization not fully characterizedCritical for mtDNA nucleoid organization and stability
ExpressionConstitutive expression in various growth conditionsSimilar expression patterns under standard conditions
Phenotype of deletionPhenotypic effects in S. pombe not fully characterizedDeletion causes giant spherical mitochondria with aberrant internal structure

The observed functional differences may reflect the distinct mitochondrial biology between these distantly related yeasts. S. pombe (fission yeast) and S. cerevisiae (budding yeast) diverged approximately 350-900 million years ago and have evolved different mechanisms for various cellular processes .

What are the key structural differences between Mdm31 proteins across yeast species?

Comparative analysis reveals several notable structural differences:

  • Sequence homology: Despite functional conservation, sequence identity between S. pombe and S. cerevisiae Mdm31 is approximately 25-30%, with higher conservation in functional domains.

  • Domain organization: Both proteins contain transmembrane domains, but differences exist in the number and arrangement of these domains, potentially reflecting adaptation to different mitochondrial membrane architectures.

  • Protein interaction motifs: Analysis suggests differences in protein-protein interaction domains, consistent with the formation of species-specific protein complexes.

  • Post-translational modifications: Different patterns of phosphorylation and other modifications may contribute to species-specific regulation .

These structural differences might explain the distinct protein complex formations observed in different yeast species - with S. cerevisiae Mdm31 forming a complex of ~600 kDa while Mdm32 forms a separate complex of ~175 kDa .

How can researchers effectively study the role of Mdm31 in mitochondrial membrane architecture?

To investigate Mdm31's role in mitochondrial membrane architecture, researchers should employ multiple complementary approaches:

  • Super-resolution microscopy: Techniques like STORM, PALM or STED microscopy can visualize the nanoscale distribution of fluorescently-tagged Mdm31 within mitochondrial membranes, revealing its spatial relationship with other mitochondrial structures.

  • Electron microscopy: Immunogold labeling combined with transmission electron microscopy can precisely localize Mdm31 within the mitochondrial ultrastructure.

  • Mitochondrial fractionation: Subfractionation of mitochondrial compartments followed by proteomic analysis can identify the submitochondrial localization of Mdm31 and its interacting partners.

  • Lipid interaction studies: Liposome binding assays using recombinant Mdm31 can reveal potential lipid preferences that might influence membrane architecture.

  • Genetic complementation assays: Testing whether S. pombe Mdm31 can complement S. cerevisiae mdm31 deletion mutants and vice versa can reveal functional conservation versus specialization .

  • Cryo-electron tomography: This technique can visualize mitochondrial membrane contacts and structure in near-native conditions, potentially revealing Mdm31's role in membrane organization.

What approaches can elucidate the protein complexes involving Mdm31 in S. pombe?

To characterize Mdm31-containing protein complexes in S. pombe:

  • Size exclusion chromatography: This technique can determine the native size of Mdm31-containing complexes in solubilized mitochondrial membranes, similar to the approach used for S. cerevisiae where Mdm31 was found in a complex of ~600 kDa .

  • Blue native PAGE: This method preserves native protein complexes and can reveal the composition and size of Mdm31-containing complexes.

  • Proximity labeling methods: BioID or APEX2 fused to Mdm31 can identify proximal proteins in the native mitochondrial environment.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry can capture transient interactions and identify contact sites between Mdm31 and other proteins.

  • Co-immunoprecipitation with quantitative proteomics: Immunoprecipitation of tagged Mdm31 followed by mass spectrometry can identify stable interaction partners.

  • Multi-angle light scattering: When combined with size exclusion chromatography, this technique provides precise determination of molecular mass and stoichiometry of protein complexes .

What phenotypic assays best characterize mdm31 deletion or mutation in S. pombe?

To comprehensively assess mdm31 deletion or mutation phenotypes in S. pombe:

  • Mitochondrial morphology analysis: Fluorescence microscopy using mitochondria-targeted fluorescent proteins can visualize changes in mitochondrial shape, size, and distribution. Quantitative parameters should include mitochondrial length, branching frequency, and distribution throughout the cell.

  • mtDNA stability assays: Assessing the rate of mtDNA loss over generations in glucose-containing medium provides insight into mtDNA maintenance functions, similar to approaches used in S. cerevisiae where mdm31 deletion strains showed ~50% loss of respiratory competence after 3 days .

  • Respiratory capacity measurements: Oxygen consumption rate measurements and growth assessments on non-fermentable carbon sources (like glycerol) at different temperatures can reveal respiratory defects. S. cerevisiae mdm31/mdm32 double mutants showed more severe growth defects on non-fermentable carbon sources at elevated temperatures .

  • mtDNA nucleoid visualization: DAPI staining or fluorescent tagging of nucleoid proteins can reveal changes in mtDNA organization and distribution.

  • Electron microscopy analysis: Ultrastructural examination of mitochondrial inner membrane architecture can reveal specific structural abnormalities.

  • Mitochondrial inheritance during cell division: Live-cell imaging of mitochondrial distribution during cell division can reveal defects in mitochondrial segregation .

How can researchers investigate potential genetic interactions between mdm31 and other mitochondrial genes in S. pombe?

To explore genetic interactions of mdm31 in S. pombe:

  • Synthetic genetic array (SGA) analysis: Systematic construction of double mutants between mdm31 and other mitochondrial genes can identify genetic interactions. In S. cerevisiae, mdm31 deletion showed synthetic lethality with mmm1, mmm2, mdm10, and mdm12 deletions .

  • Tetrad analysis: For specific gene combinations of interest, tetrad analysis provides detailed information on genetic interactions.

  • Genetic suppressor screens: Identifying suppressors of mdm31 deletion phenotypes can reveal functional relationships and compensatory pathways.

  • RNA-seq analysis: Transcriptome profiling of mdm31 mutants can identify compensatory gene expression changes.

  • Epistasis analysis: Determining the phenotypes of double mutants compared to single mutants can establish gene order in pathways.

  • Cross-species complementation: Testing whether known interactors of S. cerevisiae Mdm31 (like Mmm1, Mmm2, Mdm10, and Mdm12) have similar relationships with S. pombe Mdm31 .

What biophysical techniques can determine the membrane topology and structure of S. pombe Mdm31?

Several advanced biophysical techniques can elucidate Mdm31's membrane topology and structure:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify solvent-exposed regions versus membrane-embedded domains of Mdm31.

  • Single-particle cryo-electron microscopy: For purified Mdm31 complexes reconstituted into nanodiscs or detergent micelles to determine three-dimensional structure.

  • Site-directed fluorescence labeling: Strategic labeling of cysteine residues followed by fluorescence spectroscopy can probe conformational changes and accessibility of different protein domains.

  • EPR spectroscopy: Spin-labeled Mdm31 can provide information about dynamics and distances between protein domains.

  • Protease protection assays: Differential susceptibility to proteases can map topology of transmembrane segments.

  • Cysteine scanning mutagenesis: Combined with accessibility reagents, this approach can map membrane-embedded versus exposed regions .

How can researchers investigate the potential role of S. pombe Mdm31 in mtDNA maintenance?

To investigate Mdm31's role in mtDNA maintenance in S. pombe:

  • mtDNA nucleoid visualization and quantification: Using fluorescent DNA-binding dyes or tagged nucleoid proteins to assess nucleoid number, size, and distribution in wild-type versus mdm31 mutant cells.

  • mtDNA copy number analysis: Quantitative PCR to measure mtDNA levels relative to nuclear DNA in mutant versus wild-type cells.

  • mtDNA mutation frequency assays: Assessing the rate of spontaneous mutations in the mitochondrial genome in the presence or absence of functional Mdm31.

  • Protein-mtDNA interaction analysis: Chromatin immunoprecipitation (ChIP) or DNA footprinting to determine if Mdm31 directly interacts with mtDNA.

  • Transmission electron microscopy: To visualize the association between the mitochondrial inner membrane and nucleoids in the presence and absence of Mdm31.

  • Co-localization studies: Fluorescence microscopy to determine if Mdm31 co-localizes with mtDNA nucleoids and known nucleoid proteins, similar to studies in S. cerevisiae that showed association between Mdm31 and Mmm1-containing complexes involved in mtDNA inheritance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.