Recombinant Schizosaccharomyces pombe Mitochondrial escape protein 2 (yme2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yme2; SPBC83.05; Mitochondrial escape protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-773
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
yme2
Target Protein Sequence
AHSLVAHNIGHIKLDPNEGLFFVDNLVNTPTYFYIQRYTALLFQNNLKKQLSAAFPSSDT MQLEDIIFRWQDGGAFLKVRYKEFPQDTEAVSEHVRESFRKRPVRTILHPFSTPIPHMVH GIPWLQDLYIFPSRTVDVNFEGPPLSQERLYSIFRTYGKLRSVTINSPTSATLSFSSLRS ATSALNCMHGFVYGKTEFHMRYRHMNRFVAFKDWLFSHPRFTIPLVAAAITVLTASLFDP IRKFFVETNIVHGQKLRNINVVGWVKKKTRDIVLSPFHENGTNIKAPIWTTREKDCEQLK EWLDEALHSFIVVQGPRGSGKRDLVDRVVKERKNVLFFDCDRLFSTTNTEMFVSTLASQT GYFPLFSFLNNISSLIDMAAQGLIGQKTGIVSSSEGQVRQILNTTQTVLRSLALREHKEA DTSVLDESEFLEVHADRLPVVILDNFQLRKLSNPMQRVVAEWAGNLVKEGIAHVLMLTPD VGGTKSLEQYVNGWENRTLLLGDADPVLAQRYVIESLPEEMQTEELRKELRVQLPKIGGR LRDLDYVARRLRVNSSSVSEAIGGIVSQNASDILQTFLRPASLTSEEKPTFTPEESWTLI TYLSQHEYIPYHMLMLDPLFKGHDDAVRALEESELITITTVNARPDKVYAGKPVYVTAFR QLVNDPVLSANMQLVRCNALIGMANNAIKNDEQELQMLKDLGNLESGVKDRAHYLTTRIQ KNQGVITDNEKSIERLTEALKKID
Uniprot No.

Target Background

Function
This protein plays a critical role in maintaining the mitochondrial genome and regulating mtDNA escape. It is involved in controlling mtDNA nucleotide structure and number. A potential, albeit potentially minor, role in early pre-rRNA maturation has also been suggested.
Database Links
Protein Families
YME2 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the domain architecture of S. pombe Yme2 protein?

S. pombe Yme2 possesses two distinct functional domains that contribute to its role in mitochondrial processes. Recent structural analyses have revealed that Yme2 contains an RNA recognition motif (RRM) that faces the mitochondrial matrix and a AAA+ domain that is located in the intermembrane space . This topology suggests a dual function in RNA processing and protein interactions across mitochondrial compartments.

The full-length mature protein spans amino acids 30-773 and contains Walker motifs characteristic of ATP-binding proteins . The protein's architecture can be visualized as follows:

DomainPositionOrientationFunction
RNA Recognition Motif (RRM)N-terminal regionMatrix-facingRNA binding/processing
Transmembrane segmentCentral regionSpans inner membraneMembrane anchoring
AAA+ domainC-terminal regionIntermembrane spaceProtein complex assembly

How does Yme2 interact with the mitochondrial protein biogenesis machinery?

Yme2 forms a high molecular weight complex and genetically interacts with multiple components of the mitochondrial protein biogenesis machinery. Studies have demonstrated that YME2 genetically interacts with MDM38, MBA1, and OXA1, linking its function directly to mitochondrial protein biogenesis pathways . This interaction network positions Yme2 as a crucial component in coordinating mitochondrial gene expression with protein integration into the inner membrane.

The interaction pattern suggests that Yme2 may function as a bridge between mitochondrial translation and membrane protein insertion, potentially recognizing specific mitochondrial RNAs through its RRM domain while facilitating protein integration via its AAA+ domain.

What expression systems yield optimal recombinant S. pombe Yme2 protein?

While multiple expression systems have been evaluated, E. coli has emerged as the preferred host for recombinant S. pombe Yme2 production. Current protocols utilize N-terminal His-tagged constructs expressing the mature protein (amino acids 30-773) . This approach allows for efficient purification while maintaining protein functionality.

When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli expression

  • Inclusion of appropriate protease cleavage sites for tag removal

  • Selection of a vector system with tunable expression levels

  • Growth at lower temperatures (16-18°C) to enhance proper folding

How can researchers optimize purification protocols for recombinant Yme2?

Purification of recombinant Yme2 requires careful consideration of its structural properties. The following protocol has demonstrated success in obtaining high-purity protein:

  • Initial capture using Ni-NTA affinity chromatography with a Tris/PBS-based buffer (pH 8.0)

  • Purification to >90% homogeneity as determined by SDS-PAGE

  • Storage in Tris/PBS buffer with 6% trehalose to maintain stability

  • Lyophilization for long-term storage

To prevent protein aggregation during purification:

  • Maintain reduced temperature throughout the process

  • Include low concentrations of non-ionic detergents when handling full-length protein

  • Consider adding ATP or ATP analogs to stabilize the AAA+ domain

  • Avoid repeated freeze-thaw cycles which significantly reduce activity

What methods are available for studying Yme2's role in mitochondrial RNA processing?

To investigate Yme2's RNA-binding capacity and potential role in mitochondrial RNA processing, researchers should consider the following approaches:

  • RNA Immunoprecipitation (RIP): Using tagged Yme2 to identify associated RNAs in vivo

  • Electrophoretic Mobility Shift Assays (EMSA): To characterize direct RNA-protein interactions in vitro

  • Northern blot analysis: To detect changes in mitochondrial RNA processing patterns in Yme2 mutants, similar to methods used to study S. pombe mitochondrial transcription

  • Comparative analysis with known mitochondrial RNA processing pathways: S. pombe mitochondrial genome is transcribed in two major units, each producing a large precursor RNA that requires processing

When designing experiments, it's crucial to consider that S. pombe mitochondrial gene expression differs from that of S. cerevisiae, with distinct transcription and RNA processing mechanisms .

How should researchers design experiments to investigate Yme2's protein interactions?

To characterize Yme2's protein interactome, multiple complementary approaches should be employed:

  • Immunoprecipitation-mass spectrometry (IP-MS): Similar to approaches used for S. pombe transcription factors

  • Yeast two-hybrid screening: To identify direct protein interactions

  • Co-immunoprecipitation of candidate partners: Based on genetic interaction data (MDM38, MBA1, OXA1)

  • Blue native PAGE: To analyze the composition of Yme2's high molecular weight complex

When interpreting interaction data, researchers should be aware that transient or weak interactions might be missed using standard approaches. Consider employing crosslinking strategies to capture more dynamic interactions.

What approaches are most effective for generating Yme2 mutants in S. pombe?

Creating targeted Yme2 mutations in S. pombe requires careful experimental design. The following methodologies have proven successful:

  • PCR-based gene targeting: Similar to methods used for creating comprehensive strain libraries in S. pombe

  • CRISPR-Cas9 genome editing: For precise modifications without introducing selection markers

  • Domain-specific mutations: Particularly targeting the RRM and Walker motifs in the AAA+ domain

When designing mutations, consider:

  • The conservation of specific residues across species

  • The potential impact on protein folding versus function

  • The need for proper controls to verify expression levels

How can researchers assess phenotypes resulting from Yme2 mutations?

Phenotypic analysis of Yme2 mutants should encompass multiple aspects of mitochondrial function:

  • Respiratory growth: Compare growth on fermentable versus non-fermentable carbon sources

  • Mitochondrial morphology: Using fluorescent markers to visualize changes in mitochondrial structure

  • Protein import and assembly: Measuring the efficiency of nuclear-encoded protein import into mitochondria

  • Mitochondrial translation: Analyzing the synthesis of mitochondrially-encoded proteins

  • Mitochondrial RNA processing: Examining the pattern of mitochondrial transcripts using Northern blot analysis

Statistical design considerations should include appropriate controls, biological replicates, and power analysis to detect meaningful differences between wild-type and mutant strains.

What is the relationship between S. pombe Yme2 and meiotic recombination?

While Yme2 is primarily characterized as a mitochondrial protein, its potential role in nuclear processes such as meiotic recombination deserves investigation. S. pombe has been extensively used to study meiotic recombination, with multiple rec genes identified as essential for this process .

Researchers investigating potential connections should consider:

  • Examining expression patterns of Yme2 during meiosis

  • Screening for genetic interactions between Yme2 and known recombination factors

  • Analyzing recombination frequencies in Yme2 mutants using established assays

This research direction could potentially reveal unexpected nuclear roles for this mitochondrial protein or identify separate functions for splice variants or differentially localized pools of the protein.

How do the functions of Yme2 compare between S. pombe and S. cerevisiae?

Despite being distant relatives, S. pombe and S. cerevisiae share some conserved mitochondrial proteins, though their functions may differ. Comparative analysis reveals:

FeatureS. pombe Yme2S. cerevisiae Yme2Significance
Domain structureRRM and AAA+ domainsRRM and AAA+ domainsStructural conservation despite evolutionary distance
Genetic interactionsMDM38, MBA1, OXA1Similar interactionsConserved role in mitochondrial protein biogenesis
Mitochondrial contextTranscription in two major unitsDifferent transcription patternSpecies-specific adaptation to mitochondrial gene expression
Complex formationHigh molecular weight complexSimilar complex formationConserved assembly properties

When interpreting functional data across species, researchers should consider that "although some aspects of recombination are similar to those in the distantly related budding yeast Saccharomyces cerevisiae, other aspects are distinctly different" , a principle that likely extends to mitochondrial functions as well.

How should researchers approach statistical analysis of Yme2 functional studies?

Statistical approaches for Yme2 research should be tailored to the specific experimental design:

  • For interaction studies: Consider appropriate statistical tests for detecting significant interactions, such as:

    • Fisher's exact test for binary interaction data

    • Permutation tests for complex datasets

    • Multiple hypothesis correction when screening numerous potential interactions

  • For phenotypic analyses:

    • Use factorial ANOVA designs when examining multiple variables and their interactions

    • Consider split-plot or repeated measures designs when analyzing time-dependent effects

    • Apply robust statistical methods when data violate common assumptions

  • For localization studies:

    • Quantify colocalization using established statistical measures

    • Employ randomization tests to establish significance thresholds

How can researchers address inconsistent or contradictory findings regarding Yme2 function?

When faced with conflicting data about Yme2 function, researchers should:

  • Carefully examine experimental conditions, including:

    • Strain background differences

    • Expression levels of tagged constructs

    • Growth conditions and media composition

    • Assay sensitivities and limitations

  • Design critical experiments to directly test competing hypotheses

  • Consider the possibility that Yme2 may have multiple, context-dependent functions

  • Integrate diverse experimental approaches (genetic, biochemical, structural) to build a comprehensive model of Yme2 function

Remember that "the roles of identified orthologs in regulating recombination often differ" between yeast species , suggesting that protein functions can evolve despite sequence conservation.

What are the most promising avenues for future Yme2 research?

Several high-impact research directions emerge from current Yme2 knowledge:

  • Structural biology approaches: Determining high-resolution structures of Yme2's RRM and AAA+ domains to understand mechanism

  • Identification of RNA targets: Comprehensive analysis of RNAs bound by Yme2's RRM domain

  • Integration with broader mitochondrial biology: Investigating how Yme2 coordinates with other mitochondrial systems

  • Evolutionary analysis: Comparing Yme2 function across diverse fungal species to understand functional conservation and divergence

  • Human relevance: Investigating potential human orthologs and their involvement in mitochondrial diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.