Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim21 (tim21)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Schizosaccharomyces pombe Tim21 is a recombinant protein corresponding to the Tim21 subunit of the TIM23 complex, a mitochondrial inner membrane translocase critical for importing presequence-containing proteins into the matrix. Native Tim21 bridges the translocase of the outer membrane (TOM complex) and the TIM23 complex, facilitating efficient protein translocation . Recombinant Tim21 is engineered for structural, functional, and biochemical studies, often expressed in E. coli or other heterologous systems .

Native Tim21 Structure

Tim21 comprises a single transmembrane domain and an intermembrane space (IMS)-exposed domain. The IMS domain adopts a novel α/β-mixed fold with two α-helices flanked by an eight-stranded β-sheet . Key features include:

  • Electrostatic Interactions: Positively charged residues on Tim21’s surface bind to negatively charged residues in the IMS domain of Tom22 (a TOM complex receptor), stabilizing TOM-TIM23 contact sites .

  • Core Binding Sequence: A 17-residue segment of Tom22 (residues 176–192) mediates binding to Tim21, with two negatively charged residues (Asp181 and Glu184) critical for interaction .

Role in Mitochondrial Translocation

Tim21 acts as a “molecular bridge” between the TOM and TIM23 complexes. It binds to the trans-side of the TOM complex, maintaining proximity between the two translocases during preprotein transfer . This interaction is disrupted by presequence peptides, which compete for binding to Tom22 .

Functional Studies

  • Crystallography: The 1.6 Å resolution structure of Saccharomyces cerevisiae Tim21 revealed its α/β-fold and electrostatic interface with Tom22 .

  • Mutagenesis: Disruption of Tim21-Tom22 binding impairs mitochondrial protein import efficiency .

Recombinant Protein Utility

Recombinant Tim21 is used in:

  1. Structural Biology: Studying TOM-TIM23 interactions via X-ray crystallography or NMR .

  2. Binding Assays: Mapping interactions with Tom22 or TIM23 subunits (e.g., Tim23, Tim17) .

  3. Therapeutic Research: Investigating mitochondrial dysfunction in diseases linked to TIM23 dysregulation .

Stability and Activity

  • Thermal Stability: Recombinant Tim21 is stable at -20°C but degrades with repeated freeze-thaw cycles .

  • Activity: Functional assays confirm binding to Tom22 and TIM23 components .

Purity and Quality Control

Suppliers employ SDS-PAGE and Western blotting to validate purity and tag integrity .

Recombinant Tim21 is a vital tool for elucidating mitochondrial protein import mechanisms, particularly the TOM-TIM23 interaction. Its structural characterization has advanced understanding of translocase coordination, while its recombinant form enables functional and therapeutic studies. Continued research will refine its applications in mitochondrial biogenesis and disease modeling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tim21; SPBC1289.09; Mitochondrial import inner membrane translocase subunit tim21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-223
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
tim21
Target Protein Sequence
SLASDSLNKQRKPQEEGRLARIFKDPSNKAWKDLTAPQKAYRTSANIGNFSIVIFGGGVF GLIIYALVTSIWKGEAHYGDEAFELLKANEECRYVFGDHMKALGEATHPLRRTHGILTSR VWDHHGVEHLVLQFHLIGNERKGHVFGRLVNVQGDYKWEYLFVDVANYGKIIIFDHTNSV RQQHKNFGLWGSLKNITWGN
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, this protein facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It maintains close contact between the TOM and TIM23 complexes, temporarily detaching from the TOM23 complex to enable protein translocation into the mitochondrial matrix.
Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the function of Tim21 within the mitochondrial import machinery of S. pombe?

Tim21 functions as a peripheral subunit of the presequence translocase of the mitochondrial inner membrane (TIM23) complex, which represents the major route for import of nuclear-encoded proteins into mitochondria. While Tim17 has been identified as the primary subunit directly involved in the translocation of presequence proteins across the inner membrane, Tim21 plays a critical role as a dynamic adapter that connects the TIM23 complex to the translocase of the outer membrane (TOM) complex . This connection facilitates efficient transfer of preproteins from the TOM complex to the TIM23 complex. Additionally, Tim21 is involved in the dynamic association of the respiratory chain complexes with the TIM23 complex, coupling respiration with protein import.

How should I design primers for cloning S. pombe tim21 for recombinant expression?

When designing primers for cloning S. pombe tim21, consider the following methodological approach:

  • Examine the complete genomic sequence of S. pombe to identify potential variations in subtelomeric regions, as these show relatively high frequency of nucleotide variations among strains compared to other chromosomal regions .

  • Design primers that:

    • Include appropriate restriction sites compatible with your expression vector

    • Avoid regions with high secondary structure

    • Account for S. pombe codon usage

    • Include a Kozak consensus sequence if expressing in eukaryotic systems

    • Consider adding purification tags (His, GST, etc.) while ensuring they don't interfere with protein function

  • Validate primer specificity against the S. pombe genome to avoid off-target amplification, particularly important given the mosaic nature of some regions showing high variation among strains .

  • Include at least 18-25 nucleotides of gene-specific sequence beyond any added features (tags, restriction sites) to ensure specific binding.

What expression systems are most suitable for producing recombinant S. pombe Tim21?

For optimal expression of recombinant S. pombe Tim21, consider the following methodological comparison:

Expression SystemAdvantagesDisadvantagesRecommended Conditions
E. coli- High yield
- Cost-effective
- Rapid production
- Potential misfolding
- Lack of post-translational modifications
- Potential toxicity
- BL21(DE3) strain
- Low induction temperature (16-20°C)
- Use of solubility tags (MBP, SUMO)
S. cerevisiae- Closer to native conditions
- Post-translational modifications
- Proper folding
- Lower yield than E. coli
- Longer expression time
- GAL1 promoter
- Optimal growth at 30°C
- Consider protease-deficient strains
S. pombe- Native post-translational modifications
- Authentic folding
- Natural interaction partners
- Lower yield
- Technically challenging
- nmt1 promoter system
- Monitor phosphorylation state
- Consider cell-cycle timing
Insect cells- High-level expression
- Complex protein folding
- Post-translational modifications
- Higher cost
- Technical complexity
- Baculovirus expression
- Sf9 or High Five cells
- 27-28°C for 48-72 hours

When using the S. pombe expression system, consider the repressible nmt1 promoter, as this has been successfully used for expression control of other proteins in S. pombe . Additionally, monitor the phosphorylation state of your recombinant protein, as phosphorylation plays a key role in regulating protein function during the cell cycle in S. pombe, as demonstrated with Rad21 .

What purification strategy should I use for recombinant S. pombe Tim21?

For purifying recombinant S. pombe Tim21, implement this methodological workflow:

  • Mitochondrial isolation: Begin with isolation of intact mitochondria using differential centrifugation followed by sucrose gradient purification, similar to protocols used for protein import studies .

  • Solubilization: Carefully solubilize mitochondrial membranes using mild detergents such as digitonin (0.5-1%), n-dodecyl-β-D-maltoside (0.5-1%), or CHAPS (0.5-2%) to maintain protein-protein interactions within the TIM complex.

  • Affinity chromatography: If your recombinant Tim21 contains an affinity tag, use the appropriate affinity resin. For His-tagged proteins, use Ni-NTA under native conditions with imidazole gradients (20-250 mM).

  • Size exclusion chromatography: Further purify the protein using gel filtration to separate monomeric Tim21 from aggregates or complexes with other proteins.

  • Ion exchange chromatography: Consider using weak anion exchange as a final polishing step, particularly if dealing with different phosphorylation states of Tim21, as phosphorylation state variations have been observed in other S. pombe proteins involved in mitochondrial function .

  • Quality control: Verify purity using SDS-PAGE and Western blotting, and confirm functionality through protein import assays with isolated mitochondria.

How can I characterize the interaction between recombinant Tim21 and other components of the TIM23 complex?

To characterize the interactions between recombinant Tim21 and other components of the TIM23 complex, employ the following advanced methodological approaches:

  • Site-specific crosslinking: Design crosslinking experiments similar to those used to study preprotein interactions with TIM23 components . Use heterobifunctional crosslinkers with different spacer arm lengths to map the interaction interface. Incorporate photo-activatable or chemical crosslinkers at specific positions within Tim21 to identify interaction partners when exposed to preproteins in transit.

  • Co-immunoprecipitation with sequential elution: Use antibodies against Tim21 to pull down the entire complex, then perform sequential elution with increasing salt concentrations to determine the strength of different interactions within the complex.

  • Blue Native PAGE analysis: Solubilize mitochondria using digitonin and separate the intact complexes using Blue Native PAGE to visualize different assembly states of the TIM23 complex containing Tim21.

  • Surface plasmon resonance (SPR): Measure binding kinetics between purified recombinant Tim21 and other isolated components of the import machinery, including subunits of both TOM and TIM23 complexes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map the conformational changes in Tim21 upon binding to other components of the import machinery to identify dynamic interaction interfaces.

  • Cryo-electron microscopy: Determine the structural arrangement of Tim21 within the TIM23 complex at near-atomic resolution to understand its structural role in connecting the TOM and TIM23 complexes.

  • Reconstitution assays: Reconstitute purified components into liposomes to measure Tim21's role in protein translocation efficiency, similar to approaches used to study the role of Tim17 in the TIM23 complex .

What strategies can I use to study the phosphorylation state of recombinant Tim21 and its functional significance?

To investigate the phosphorylation state of recombinant Tim21 and its functional significance, implement this comprehensive methodological strategy:

  • Phosphorylation site mapping: Use mass spectrometry-based phosphoproteomics to identify phosphorylation sites on Tim21. Based on findings with other S. pombe proteins like Rad21, which is multiply phosphorylated mainly at serine residues and shows cell cycle-dependent phosphorylation patterns , focus particularly on serine residues.

  • Phospho-specific antibodies: Generate antibodies that specifically recognize phosphorylated forms of Tim21 to track phosphorylation states during different cellular conditions.

  • Phosphomimetic and phospho-dead mutants: Create Tim21 variants with mutations at identified phosphorylation sites:

    • Substitute serine/threonine with alanine (phospho-dead)

    • Substitute serine/threonine with aspartate or glutamate (phosphomimetic)

  • Cell cycle synchronization: Analyze Tim21 phosphorylation during different cell cycle stages using techniques successful in analyzing Rad21 phosphorylation, which showed that the most phosphorylated form appeared in S to G2 phase .

  • Kinase inhibitor screening: Use specific kinase inhibitors to identify the kinases responsible for Tim21 phosphorylation.

  • In vitro kinase assays: Incubate purified recombinant Tim21 with candidate kinases and γ-[³²P]ATP to confirm direct phosphorylation.

  • Functional impact assessment: Compare mitochondrial protein import efficiency using phosphomimetic and phospho-dead Tim21 mutants in reconstituted systems or in S. pombe strains with endogenous Tim21 replaced by the mutant versions.

  • Protein-protein interaction analysis: Determine if phosphorylation affects Tim21's interaction with other components of the import machinery using techniques like co-immunoprecipitation and crosslinking with phosphomimetic and phospho-dead mutants.

How do I design experiments to study the dynamics of Tim21 association with respiratory chain complexes during protein import?

To investigate the dynamic association of Tim21 with respiratory chain complexes during protein import, employ this advanced experimental approach:

  • Fluorescence labeling strategies:

    • Generate functional fluorescently tagged Tim21 (e.g., with GFP or mCherry) for live-cell imaging

    • Consider dual-color labeling systems as used in S. pombe mating phenotype studies to track multiple components simultaneously

    • Validate that fluorescent tags don't disrupt Tim21 function using complementation assays

  • Real-time import assays:

    • Develop in organello protein import assays using isolated mitochondria containing fluorescently labeled Tim21

    • Use radiolabeled precursor proteins similar to those described for TIM23 studies

    • Combine with time-lapse fluorescence microscopy to track Tim21 movement during import

  • Respiratory chain complex manipulation:

    • Design experiments with specific respiratory chain inhibitors (rotenone, antimycin A, oligomycin) to test the impact on Tim21 associations

    • Create S. pombe strains with mutations in specific respiratory chain components

    • Measure import efficiency under varying respiratory conditions to correlate with Tim21 dynamics

  • Proximity-based protein labeling:

    • Implement BioID or APEX2 proximity labeling fused to Tim21 to identify transient interaction partners

    • Create temporal maps of the Tim21 interaction network during different phases of protein import

    • Compare interactomes under different respiratory states

  • Single-particle tracking:

    • Use super-resolution microscopy techniques to track individual Tim21 molecules

    • Analyze diffusion coefficients under different import conditions

    • Correlate with respiratory chain activity

  • Data collection and analysis:

    • Develop quantitative metrics for association/dissociation rates

    • Create mathematical models of Tim21 dynamics based on experimental data

    • Validate models with targeted mutations that affect specific interaction interfaces

What approaches can address discrepancies in experimental results when studying Tim21 function across different S. pombe strains?

Given the natural variation observed among S. pombe isolates in various cellular processes , researchers may encounter discrepancies when studying Tim21 across different strains. Address these challenges systematically with this methodological framework:

  • Strain characterization and standardization:

    • Sequence the tim21 gene and surrounding regulatory regions across all strains used

    • Document variation in mRNA and protein expression levels between strains

    • Consider the genetic background effects, as natural isolates of S. pombe show significant phenotypic variation despite limited genetic diversity

  • Statistical design for reproducibility:

    • Implement a crowdsourced experimental design approach similar to that described in search result

    • Have multiple researchers independently test the same hypotheses about Tim21 function using standardized protocols

    • Compare results to identify strain-specific or laboratory-specific variables affecting outcomes

  • Control experiments to identify sources of variation:

    • Create isogenic strains differing only in the tim21 gene to isolate strain-specific effects

    • Perform parallel experiments across multiple strains simultaneously with identical conditions

    • Document all experimental parameters meticulously, including media composition, temperature fluctuations, and cell density

  • Cross-validation with complementary techniques:

    • Use multiple independent methods to measure the same Tim21 property or function

    • Develop in vitro reconstitution assays that remove strain-specific factors

    • Combine biochemical, genetic, and microscopy approaches to triangulate on consistent results

  • Mathematical modeling of strain-specific differences:

    • Develop models that incorporate strain-specific parameters

    • Use sensitivity analysis to identify which variables most strongly influence experimental outcomes

    • Create a predictive framework that accounts for strain variation

  • Data integration techniques:

    • Apply meta-analysis methods to combine results across strains

    • Develop correction factors based on systematic differences between strains

    • Use machine learning approaches to identify patterns in variable results

How can I develop a high-throughput screening assay to identify molecules that modulate Tim21 function?

To develop a robust high-throughput screening assay for modulators of Tim21 function, implement this methodological pipeline:

  • Assay design options:

    • In vivo growth complementation: Create S. pombe strains with temperature-sensitive tim21 mutations and screen for compounds that rescue growth defects at restrictive temperatures

    • FRET-based interaction assays: Develop fluorescently labeled Tim21 and interaction partners to monitor complex formation in real-time

    • Reconstituted protein import: Establish a simplified in vitro system using purified components and fluorescently labeled precursor proteins

  • Primary assay optimization:

    • Miniaturize to 384 or 1536-well format

    • Validate with known controls that affect mitochondrial import (e.g., uncouplers, ATP depletion)

    • Determine statistical parameters (Z'-factor, signal-to-background ratio, coefficient of variation)

    • Optimize for minimal reagent consumption while maintaining sensitivity

  • Screening compound libraries:

    • Natural product extracts derived from diverse sources

    • Synthetic chemical libraries with scaffold diversity

    • Peptide libraries based on known interaction interfaces of Tim21

  • Secondary validation assays:

    • Direct binding assays with purified recombinant Tim21

    • In organello protein import assays with isolated mitochondria

    • Cell-based assays measuring mitochondrial function

    • Counter-screens to eliminate general inhibitors of mitochondrial function

  • Data analysis and hit prioritization:

    • Implement dose-response testing for primary hits

    • Cluster compounds by structural similarity and activity profiles

    • Prioritize compounds with selective effects on Tim21 versus general mitochondrial inhibitors

  • Mechanism of action studies:

    • Use photoaffinity labeling to identify binding sites on Tim21

    • Perform resistance mutation mapping to confirm targets

    • Analyze effects on Tim21 phosphorylation state and complex formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.