Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim22 (tim22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tim22; SPBC25H2.04c; Mitochondrial import inner membrane translocase subunit tim22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
tim22
Target Protein Sequence
MSLSGLLPPNLGGNSPNADGNLTPEEKAALQQAKIIGYMNRISESCVFKSSMAGVLGFGL GGIFGMFISSLDLQHIDPKIYEKPFREQIRIQARDMGSRSFSTAKNFGLLGLIYSGSECC IEAFRAKTDIYNAIAAGVFTGGALAVRSGPKAIVLGGAGFGLFSYGIEKYMHWGE
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Mitochondrial Import Inner Membrane Translocase Subunit Tim22 (Tim22): A crucial component of the TIM22 complex, this protein facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, it functions as a voltage-activated and signal-gated channel, forming a twin-pore translocase that utilizes the membrane potential as a driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Tim22 in Schizosaccharomyces pombe mitochondria?

Tim22 serves as the core translocase subunit of the TIM22 complex, which is responsible for importing hydrophobic carrier proteins into the mitochondrial inner membrane . In S. pombe, as in other eukaryotes, this process is essential for proper mitochondrial function, as most mitochondrial proteins are encoded by the nuclear genome and must be imported from the cytosol . The Tim22 protein forms a partial pore in the inner membrane that facilitates the insertion of multi-transmembrane spanning proteins with internal targeting signals .

How does the S. pombe TIM22 complex differ from that of Saccharomyces cerevisiae?

While the core function is conserved, there are significant differences in complex composition between these yeast species:

FeatureS. cerevisiae TIM22 ComplexS. pombe TIM22 Complex
Core componentsTim22, Tim18, Tim54, Sdh3, Tim9, Tim10, Tim12Tim22, Tim9, Tim10 orthologs
StructureTim18-Sdh3 heterodimer with pseudo two-fold symmetryNot fully characterized
Small Tim proteinsTim9-Tim10-Tim12 hexamerPresence of Tim9-Tim10 proteins confirmed
Additional components-Potential species-specific components

The S. cerevisiae complex has been more extensively characterized, with a known structure showing Tim22 containing four transmembrane helices forming a curved surface . While S. pombe likely shares core components, the complete composition remains less well-defined compared to S. cerevisiae .

What are the key structural features of Tim22 protein?

Tim22 in S. pombe, similar to its counterparts in other organisms, contains multiple transmembrane domains. Key structural features include:

  • Four transmembrane helices that form a partial pore open to the lipid bilayer

  • Conserved cysteine residues that form critical disulfide bonds between TM1 and TM2

  • Charged residues in the transmembrane regions that are essential for function

  • An N-terminal region that may interact with other components of the import machinery

These features enable Tim22 to form a functional translocase that can facilitate the insertion of hydrophobic carrier proteins into the inner membrane .

What are the most effective protocols for isolating and purifying recombinant S. pombe Tim22?

For successful isolation and purification of recombinant S. pombe Tim22:

  • Expression system selection: Yeast expression systems are preferred for functional studies as they provide the proper environment for folding and post-translational modifications .

  • Purification approach:

    • Add a twin-strep tag to the C-terminus of Tim22 to facilitate purification

    • Solubilize mitochondrial membranes using mild detergents to preserve protein structure

    • Use affinity chromatography with strep-tactin resins for initial purification

    • Follow with size exclusion chromatography for higher purity

  • Storage considerations:

    • Store in buffer containing 5-50% glycerol at -20°C/-80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • For short-term storage, keep working aliquots at 4°C for up to one week

For in vivo studies, genomic tagging approaches have been successfully used to study Tim22 in its native context .

How can researchers effectively analyze Tim22's integration into the mitochondrial inner membrane?

Multiple complementary approaches can be employed:

  • In vitro import assays:

    • Isolate intact mitochondria from S. pombe

    • Incubate with radiolabeled precursor proteins

    • Analyze by SDS-PAGE to track import kinetics

    • Treat with sodium carbonate to distinguish peripheral from integral membrane proteins

  • Membrane integration analysis:

    • Use carbonate extraction (pH 11.5) to distinguish between membrane-integrated and soluble/peripherally associated proteins

    • Perform proteinase K protection assays to determine topology

    • Apply blue native PAGE (BN-PAGE) to assess complex formation

  • Microscopy approaches:

    • Use fluorescently tagged Tim22 to visualize subcellular localization

    • Employ super-resolution microscopy to determine precise membrane localization

These methods allow researchers to determine not only whether Tim22 is properly inserted into the inner membrane but also its orientation and assembly into the TIM22 complex .

What methods are recommended for functional characterization of S. pombe Tim22?

Functional characterization requires multiple approaches:

  • Genetic analysis:

    • Generate point mutations in conserved residues (particularly charged residues in TM domains)

    • Assess growth phenotypes under various conditions (temperature sensitivity, carbon source)

    • Construct deletion strains if the gene is not essential, or use conditional promoters

  • In vitro import assays:

    • Isolate mitochondria from wild-type and mutant strains

    • Compare import efficiency of known TIM22 substrates (carrier proteins)

    • Measure membrane potential dependence of import

  • Biochemical characterization:

    • Analyze complex assembly using BN-PAGE

    • Perform crosslinking studies to identify interacting partners

    • Use proteomics approaches to identify changes in the mitochondrial proteome

  • Structural studies:

    • Purify the TIM22 complex for cryo-EM analysis

    • Use chemical crosslinking combined with mass spectrometry (XL-MS) to map interactions

These approaches provide complementary information about Tim22 function in the context of the TIM22 complex .

How does the structure of Tim22 relate to its function in protein import?

The structure-function relationship of Tim22 involves several key features:

  • Pore formation:

    • The four transmembrane helices of Tim22 form a partial pore open to the lipid bilayer

    • This unusual structure allows for lateral release of substrate proteins into the membrane

  • Critical structural elements:

    • Disulfide bond between TM1 and TM2 (formed by conserved cysteine residues) is essential for stability

    • Charged residues in the transmembrane regions (particularly E140 and K127 in S. cerevisiae) are crucial for function

    • Mutations in these conserved charged residues severely impair yeast growth while not affecting complex assembly

  • Electrostatic features:

    • Large negatively charged patch on the concave surface exposed to the membrane on the IMS side

    • Shorter transmembrane distance due to the TM2-TM3 split on the matrix side

    • These features may facilitate substrate protein insertion by reducing the energy barrier for transmembrane domain insertion

Understanding these structural features provides insight into how Tim22 functions as a protein translocase, potentially allowing local thinning of the membrane to reduce the energy barrier for insertion of carrier proteins .

What techniques have been most informative for determining TIM22 complex architecture in S. pombe?

Multiple complementary techniques have advanced our understanding of TIM22 complex architecture:

While most detailed structural studies have been performed with S. cerevisiae or human TIM22 complexes, similar approaches can be applied to the S. pombe complex to determine species-specific architectural features .

How do researchers analyze the impact of mutations in Tim22 on mitochondrial protein import?

Analysis of Tim22 mutations involves several experimental approaches:

  • Systematic mutagenesis:

    • Target conserved residues, particularly charged amino acids in transmembrane regions

    • Create point mutations using site-directed mutagenesis

    • Generate single, double, and multiple mutations to assess additive effects

  • Functional assays:

    • Growth phenotype analysis under various conditions

    • In vitro import assays using isolated mitochondria

    • Membrane potential measurements to assess mitochondrial integrity

  • Complex assembly analysis:

    • Blue native PAGE to assess TIM22 complex formation

    • Co-immunoprecipitation to identify altered protein interactions

    • Crosslinking studies to detect changes in proximity relationships

  • Substrate specificity analysis:

    • Import assays with different TIM22 substrates

    • Comparison of carrier protein levels in mitochondria

    • Analysis of membrane integration efficiency

In S. cerevisiae, mutations in charged residues (E140A, K127A) significantly impaired growth, while double mutants (E140A/D190A, K127A/K169A) were lethal, demonstrating their critical importance for Tim22 function without affecting complex assembly .

How does the S. pombe TIM22 complex compare to the human TIM22 complex?

The human and S. pombe TIM22 complexes share core functions but differ in composition:

FeatureHuman TIM22 ComplexS. pombe TIM22 Complex
Core componentsTim22, Tim29, AGKTim22
Small Tim proteinsTim9, Tim10a, Tim10bTim9, Tim10 orthologs
Specific featuresTim29 (metazoan-specific) links TOM and TIM22 complexesLess characterized
Complex organizationTwo TIM chaperone hexamers: Tim9-Tim10a (3:3) and Tim9-Tim10a-Tim10b (2:3:1)Not fully determined
Unique componentsAGK (acylglycerol kinase)Potential species-specific components

The human complex has evolved additional components like Tim29, which is metazoan-specific and serves as a physical link between the TOM and TIM22 complexes, a connection not reported in yeast systems . This highlights the importance of studying mitochondrial import systems across phylogenetic boundaries to identify species-specific adaptations .

What insights can be gained from studying Tim22 across different species?

Comparative analysis of Tim22 across species provides valuable insights:

  • Evolutionary conservation and divergence:

    • Core functions and structural features are conserved

    • Species-specific adaptations reflect unique cellular requirements

    • Novel components may reveal alternative regulatory mechanisms

  • Functional insights:

    • Conserved residues likely indicate essential functions

    • Species-specific features may reflect adaptations to different mitochondrial roles

    • Unique interaction partners suggest specialized regulatory mechanisms

  • Disease relevance:

    • Understanding yeast Tim22 provides a foundation for studying human orthologs

    • Mutations in human TIM22 components are linked to mitochondrial disorders

    • S. pombe may serve as a model for certain aspects of human mitochondrial disease

The identification of Tim29 in humans but not in yeast demonstrates how evolutionary divergence has created species-specific mechanisms for mitochondrial protein import, highlighting the importance of studying this process across different organisms .

How does the process of mitochondrial protein import in S. pombe compare with other model organisms?

Mitochondrial protein import in S. pombe shares core principles with other eukaryotes but has unique features:

  • Common principles across species:

    • Most mitochondrial proteins are nuclear-encoded and imported post-translationally

    • The TOM complex serves as the general entry gate

    • Specialized translocases (TIM23, TIM22) direct proteins to specific compartments

  • S. pombe-specific features:

    • Import efficiency may be lower compared to S. cerevisiae in in vitro assays

    • External ATP is required for protein import into isolated S. pombe mitochondria

    • This may reflect a generally lower energetic state of S. pombe mitochondria

  • Processing mechanisms:

    • Sequential processing of some mitochondrial proteins occurs in S. pombe

    • Example: pre-Rsm22-Cox11 undergoes two proteolytic steps after import

    • First, removal of the presequence, then separation of the Rsm22 and Cox11 domains

  • Tandem protein organization:

    • S. pombe genome encodes several tandem mitochondrial proteins

    • These are often processed post-import to yield separate functional proteins

    • May serve to coordinate expression or enhance import efficiency

Understanding these differences enriches our knowledge of mitochondrial biology and evolution while providing insights into fundamental cellular processes .

How might Tim22 function be integrated with other cellular processes in S. pombe?

The function of Tim22 may extend beyond protein import to influence broader cellular processes:

  • Integration with cell cycle and stress responses:

    • Mitochondrial function is tightly regulated during the cell cycle

    • In S. pombe, checkpoint responses to DNA damage involve mitochondrial components

    • Tim22-mediated protein import may be regulated during stress conditions

  • Coordination with mitochondrial dynamics:

    • Mitochondrial fusion/fission processes require membrane protein trafficking

    • TIM22 complex function may be synchronized with these dynamics

    • Potential regulatory mechanisms could involve phosphorylation or other modifications

  • Connections to metabolism:

    • Carrier proteins imported by TIM22 are essential for metabolite transport

    • Changes in metabolic requirements may influence TIM22 activity

    • Integration with signaling pathways could coordinate import with cellular needs

  • Potential links to meiotic processes:

    • S. pombe has unusually high meiotic recombination rates

    • Proper mitochondrial function is essential during meiosis

    • Tim22 may play roles in ensuring appropriate mitochondrial activity during meiosis

Future research could explore these connections, potentially revealing new regulatory mechanisms and functional relationships .

What are the current technical challenges in studying Tim22 and how might they be overcome?

Several technical challenges persist in Tim22 research:

  • Structural analysis limitations:

    • Challenge: Obtaining high-resolution structures of membrane protein complexes

    • Solution approaches:

      • Advanced cryo-EM techniques with improved detectors

      • Novel membrane mimetics (nanodiscs, amphipols)

      • Integrative structural biology combining multiple methods

  • Functional reconstitution:

    • Challenge: Reconstituting Tim22 activity in vitro

    • Solution approaches:

      • Artificial membrane systems (liposomes, planar bilayers)

      • Development of electrical recording techniques for translocase activity

      • Cell-free expression systems coupled with functional assays

  • Dynamic analysis:

    • Challenge: Capturing the dynamic process of protein translocation

    • Solution approaches:

      • Single-molecule techniques to observe translocation events

      • Time-resolved crosslinking to capture intermediates

      • Development of assays to measure translocation kinetics in real-time

  • Specificity determinants:

    • Challenge: Understanding how Tim22 recognizes diverse substrates

    • Solution approaches:

      • Systematic mutagenesis of Tim22 and substrates

      • Development of in vitro binding assays

      • Computational modeling of substrate-translocase interactions

Overcoming these challenges will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational methods .

What emerging technologies might advance our understanding of Tim22 function in S. pombe?

Several emerging technologies hold promise for advancing Tim22 research:

  • CRISPR-based approaches:

    • Precise genome editing for structure-function studies

    • CRISPRi for conditional depletion of essential components

    • CRISPR screening to identify genetic interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualization of mitochondrial substructures

    • Single-molecule tracking to observe Tim22 dynamics

    • Correlative light and electron microscopy (CLEM) to link function with ultrastructure

  • Proteomics advancements:

    • Proximity labeling (BioID, APEX) to identify transient interactions

    • Quantitative proteomics to measure global effects of Tim22 manipulation

    • Targeted proteomics for accurate quantification of low-abundance components

  • Systems biology approaches:

    • Integration of multi-omics data (proteomics, metabolomics, transcriptomics)

    • Network analysis to position Tim22 in broader cellular pathways

    • Computational modeling of mitochondrial protein import dynamics

  • Cryo-electron tomography:

    • Visualization of Tim22 complexes in their native membrane environment

    • Analysis of spatial distribution and organization in intact mitochondria

    • Potential to observe translocase function in situ

These technologies, particularly when combined, promise to provide unprecedented insights into Tim22 function and regulation in S. pombe .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.