Recombinant Schizosaccharomyces pombe Mitochondrial inner membrane magnesium transporter mrs2 (mrs2)

Shipped with Ice Packs
In Stock

Description

Function and Importance of Mrs2

Mrs2 is vital for the proper functioning of mitochondria, as it helps regulate the concentration of magnesium ions within these organelles. Magnesium is a cofactor for many enzymes involved in energy production, particularly in the tricarboxylic acid (TCA) cycle and oxidative phosphorylation. The absence or malfunction of Mrs2 can lead to disruptions in mitochondrial energy metabolism, affecting ATP production and increasing cellular vulnerability to stress .

Key Functions of Mrs2:

  • Magnesium Transport: Facilitates the influx of magnesium ions into the mitochondrial matrix.

  • Energy Metabolism: Essential for maintaining mitochondrial membrane potential and ATP production.

  • mRNA Splicing: Plays a role in the splicing of mRNA, which is crucial for protein synthesis .

Research Highlights:

  • Mitochondrial Mg2+ Homeostasis: Mrs2 is critical for regulating mitochondrial magnesium levels, which affects cellular energy status and vulnerability to stress .

  • ATP Production: Disruptions in Mrs2 function can lead to imbalances in ATP production and export from mitochondria .

  • Cellular Stress Sensitivity: Cells lacking Mrs2 are more susceptible to stress conditions due to impaired mitochondrial function .

Recombinant Mrs2 Protein

The recombinant Mrs2 protein is available for research purposes, allowing scientists to study its function and interactions in detail. This protein is produced in various host systems, including E. coli, yeast, or mammalian cells, and is typically stored in a liquid form containing glycerol .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mrs2; SPBC25H2.08c; Mitochondrial inner membrane magnesium transporter mrs2; RNA-splicing protein mrs2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-422
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mrs2
Target Protein Sequence
ATDSNPLITGFPETSKNCPPSVAATKNRLLMNCTEFDDHGNVRVISGDFKKMDLCKQNGL LPRDLRKLNTSINSIVPVILVREGSILINLLHIRALIKANSVLLFDVYGSQHSHSQSQFI YELEGRLKQKSSDFGWLPYEMRALETILVSVVNTLDSELHVLHNLVSDLLADFELDINQE RLRTLLIFSKRLSGFLKKATLIRDVLDELLEQDQDLAGMYLTERLKTGKPRDLDKHDEVE LLLETYCKQVDEIVQQTDNLVGNIRSTEEICNIMLDANRNSLMLLGLKLSAMTLGLGFGA VVASLYGMNLQNGLENHPYAFYITTGSIFAFAAFLSSLGILKIRRLKRIQMALYHRCNLP ISLDPRSLRPPYL
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Mitochondrial inner membrane magnesium transporter mrs2 (mrs2) is a high-conductance magnesium-selective channel facilitating magnesium influx into the mitochondrial matrix. It plays a crucial role in the splicing of mitochondrial group II introns by modulating mitochondrial magnesium concentrations, essential for this process. Furthermore, mrs2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Mrs2 in Schizosaccharomyces pombe?

Mrs2 functions as an essential component of the high-capacity magnesium influx system in the inner mitochondrial membrane of S. pombe. It forms a channel that facilitates Mg²⁺ transport into mitochondria, driven by the mitochondrial membrane potential (Δψ). This protein is critical for maintaining proper mitochondrial Mg²⁺ homeostasis, as demonstrated by studies showing that deletion of the MRS2 gene abolishes high-capacity Mg²⁺ influx into mitochondria . Methodologically, this has been confirmed using fluorescent dyes such as mag-fura 2 to continuously measure free Mg²⁺ concentrations in isolated mitochondria, showing both influx and efflux processes require Mrs2 .

How does Mrs2 structure relate to its function?

Mrs2 is a membrane protein with two transmembrane domains that shares significant structural and functional similarity with the bacterial Mg²⁺ transport protein CorA. The protein contains a highly conserved F/Y-G-M-N motif that is critical for its function. Research utilizing site-directed mutagenesis has demonstrated that mutation of this motif (for example, changing glycine to alanine in the G-M-N sequence) severely reduces Mg²⁺ transport capacity . Cross-linking experiments have revealed that Mrs2 likely forms homo-oligomeric complexes in the mitochondrial membrane, which is consistent with the channel structure necessary for its function as a metal ion transporter .

What experimental methods are used to measure Mrs2-mediated Mg²⁺ transport?

Researchers typically employ fluorescent indicators such as mag-fura 2 to measure free Mg²⁺ concentrations in isolated mitochondria. This technique allows for continuous real-time monitoring of Mg²⁺ influx and efflux. The experimental procedure involves:

  • Isolation of intact mitochondria from S. pombe cells

  • Loading mitochondria with the mag-fura 2 fluorescent dye

  • Establishing a baseline measurement in nominally Mg²⁺-free medium

  • Adding external Mg²⁺ at defined concentrations (typically 1-10 mM)

  • Monitoring fluorescence changes that correspond to Mg²⁺ concentration changes

  • Calculating influx rates based on initial slopes of fluorescence changes

Additionally, membrane potential modulators like carbonyl cyanide m-chlorophenyl hydrazone (CCCP) can be used to dissipate Δψ and study its effect on Mg²⁺ transport, while inhibitors such as cobalt(III)hexaammine can be employed to block Mrs2-mediated transport .

How should gene deletion and overexpression experiments be designed when studying Mrs2 function?

When designing gene deletion and overexpression experiments for Mrs2 research, a true experimental design with appropriate controls is essential. The methodology should include:

  • Gene Deletion Approach:

    • Generate mrs2Δ strains using targeted gene replacement techniques

    • Verify deletion by PCR and/or Southern blotting

    • Include wild-type strain as control

    • Measure both resting [Mg²⁺]m in nominally Mg²⁺-free solution and influx rates upon Mg²⁺ addition

    • Compare mitochondrial function parameters between wild-type and mrs2Δ strains

  • Overexpression Approach:

    • Clone the MRS2 gene into a multicopy plasmid under a strong promoter

    • Transform into wild-type or mrs2Δ strains

    • Verify overexpression by Western blotting

    • Compare Mg²⁺ influx rates between wild-type, mrs2Δ, and overexpression strains

Research has shown that Mrs2 overexpression increases influx rates approximately 5-fold compared to wild-type, while deletion abolishes high-capacity influx, providing clear indicators of experimental success .

What controls and variables should be considered when investigating Mrs2 in site-directed mutagenesis studies?

When conducting site-directed mutagenesis studies on Mrs2, researchers should consider:

Independent Variables:

  • Specific amino acid mutations, particularly in the conserved F/Y-G-M-N motif

  • Expression levels of mutant proteins

Dependent Variables:

  • Mg²⁺ influx rates

  • Steady-state [Mg²⁺]m levels

  • Mitochondrial functions dependent on Mg²⁺ homeostasis

Essential Controls:

  • Wild-type Mrs2 expression (positive control)

  • mrs2Δ strain (negative control)

  • Expression of mutant proteins at levels comparable to wild-type (verified by Western blotting)

  • Measurement of mitochondrial membrane potential to ensure mutations don't affect Δψ

For example, studies of the mrs2-J1 mutation (G998→C998) have shown that changing the glycine residue in the conserved motif to alanine strongly reduces Mg²⁺ influx despite normal protein expression and stability, highlighting the functional importance of this motif .

How can researchers effectively isolate mitochondria for Mrs2 functional studies?

Isolation of intact and functional mitochondria is critical for accurate Mrs2 studies. The recommended methodology includes:

  • Cell Growth and Harvesting:

    • Grow S. pombe cells in appropriate media (typically YES) at 30°C to mid-logarithmic phase

    • Harvest cells by centrifugation

    • Wash cells with buffer containing sorbitol as osmotic stabilizer

  • Cell Wall Digestion and Lysis:

    • Treat cells with zymolyase to digest the cell wall, creating spheroplasts

    • Monitor spheroplast formation microscopically

    • Gently lyse spheroplasts using Dounce homogenization in buffer containing:

      • 0.6 M sorbitol

      • 10 mM HEPES-KOH (pH 7.4)

      • 1 mM EGTA

      • Protease inhibitors

  • Differential Centrifugation:

    • Remove cell debris and nuclei by low-speed centrifugation (1,500 × g)

    • Collect mitochondria by medium-speed centrifugation (12,000 × g)

    • Wash mitochondrial pellet to remove cytosolic contaminants

  • Quality Control:

    • Verify mitochondrial integrity by measuring membrane potential

    • Assess purity by enzymatic markers (e.g., citrate synthase for mitochondria)

    • Determine protein concentration for standardization of subsequent experiments

Properly isolated mitochondria should maintain physiological responses, including Mg²⁺ transport capabilities and membrane potential sensitivity to inhibitors .

How should researchers analyze Mg²⁺ flux data in Mrs2 studies?

Analysis of Mg²⁺ flux data requires rigorous quantitative approaches:

  • Influx Rate Calculation:

    • Calculate the initial rate (slope) of [Mg²⁺]m increase after external Mg²⁺ addition

    • Express rates as nmol Mg²⁺/mg protein/min or as % change in [Mg²⁺]m/min

    • Compare rates across experimental conditions using appropriate statistical tests

  • Kinetic Analysis:

    • Measure influx rates at varying external [Mg²⁺] (typically 0.1-10 mM range)

    • Plot rate versus [Mg²⁺] to determine if transport follows Michaelis-Menten kinetics

    • Calculate apparent Km and Vmax values using non-linear regression

  • Statistical Treatment:

    • Perform at least three independent experiments with technical replicates

    • Use ANOVA for comparing multiple conditions

    • Apply post-hoc tests (e.g., Tukey's) for specific comparisons

    • Present data as mean ± standard error

  • Data Visualization:

    • Plot time-course data showing [Mg²⁺]m changes

    • Use bar graphs to compare influx rates between strains

    • Include appropriate error bars and significance indicators

Studies have shown that Mrs2 overexpression increases influx rates 5-fold compared to wild-type, providing a clear quantitative measure of Mrs2 activity .

What methods can be used to differentiate between Mrs2-specific effects and general mitochondrial dysfunction?

To distinguish Mrs2-specific effects from general mitochondrial dysfunction:

  • Parallel Assessment of Multiple Mitochondrial Functions:

    • Measure membrane potential using potential-sensitive dyes (e.g., TMRM, JC-1)

    • Assess respiratory chain activity through oxygen consumption rates

    • Evaluate ATP production capacity

    • Monitor calcium homeostasis using calcium-sensitive fluorophores

  • Genetic Complementation Tests:

    • Express wild-type Mrs2 in mrs2Δ cells to confirm phenotype rescue

    • Express functionally equivalent transporters from other species

    • Use domain-swapping experiments to identify specific functional regions

  • Specificity Controls:

    • Test transport of other divalent cations (Ca²⁺, Mn²⁺) to confirm Mg²⁺ specificity

    • Use specific inhibitors like cobalt(III)hexaammine that block Mrs2 but not other transporters

    • Compare effects in multiple genetic backgrounds

  • Data Integration Table:

ParameterWild-typemrs2ΔMrs2-overexpressionmrs2 mutant
Mg²⁺ influx rateBaselineAbolished5× increaseReduced
Resting [Mg²⁺]mBaseline-38%Slight increaseVariable
Membrane potentialNormalNormalNormalNormal
RespirationNormalAffectedNormalVariable

This integrated approach allows researchers to attribute observed phenotypes specifically to Mrs2 function rather than secondary effects .

How does Mrs2 interact with other mitochondrial proteins and pathways?

Mrs2 does not function in isolation but interfaces with various mitochondrial systems:

  • Protein-Protein Interactions:

    • Cross-linking experiments have revealed that Mrs2 likely forms homo-oligomeric complexes

    • To identify novel interaction partners, researchers should:

      • Perform co-immunoprecipitation with tagged Mrs2

      • Use proximity labeling techniques (e.g., BioID or TurboID similar to approaches used for Rtf2 )

      • Conduct yeast two-hybrid screens with Mrs2 domains

      • Apply quantitative proteomic analysis of Mrs2-containing complexes

  • Functional Pathway Analysis:

    • Investigate how Mrs2-mediated Mg²⁺ transport affects:

      • Mitochondrial translation (Mg²⁺-dependent ribosomes)

      • ATP synthesis (Mg²⁺ as cofactor for F1F0-ATPase)

      • Metabolic enzymes requiring Mg²⁺ (e.g., pyruvate dehydrogenase)

    • Perform transcriptomic analysis comparing wild-type and mrs2Δ strains

    • Use metabolomic approaches to identify metabolic pathways affected by Mrs2 deletion

  • Regulatory Mechanisms:

    • Study post-translational modifications of Mrs2 using mass spectrometry

    • Investigate transcriptional and translational regulation of Mrs2 expression

    • Examine protein turnover and stability under various cellular conditions

Understanding these interactions will provide insights into the broader role of Mrs2 in mitochondrial physiology beyond simple Mg²⁺ transport.

What is the structural basis for Mrs2 ion selectivity and gating?

Understanding the structural basis of Mrs2 function requires sophisticated approaches:

  • Structural Analysis Techniques:

    • X-ray crystallography or cryo-electron microscopy of purified Mrs2

    • Homology modeling based on bacterial CorA structures

    • Molecular dynamics simulations to study ion permeation and selectivity

  • Key Structural Features to Investigate:

    • The conserved F/Y-G-M-N motif, which is critical for function

    • Transmembrane domains that form the ion permeation pathway

    • Potential Mg²⁺ binding sites within the channel

    • Structural elements responsible for voltage sensing (Δψ-dependent activity)

  • Structure-Function Analysis:

    • Systematic mutagenesis of conserved residues

    • Chimeric proteins combining domains from Mrs2 and related transporters

    • Accessibility studies using cysteine-modifying reagents

    • Electrophysiological recordings of ion conductance (if technically feasible)

  • Ion Selectivity Determinants:

    • Identify residues determining selectivity for Mg²⁺ over other cations

    • Study coordination chemistry of Mg²⁺ within the channel

    • Investigate hydration state of Mg²⁺ during permeation

These approaches can elucidate how Mrs2 achieves selective Mg²⁺ transport and regulation by membrane potential.

How can synthetic biology approaches be applied to engineer Mrs2 with modified properties?

Synthetic biology offers powerful tools to modify Mrs2 function:

  • Rational Protein Engineering:

    • Design Mrs2 variants with altered:

      • Ion selectivity (e.g., transport of other divalent cations)

      • Transport kinetics (higher Vmax or altered Km)

      • Regulatory properties (constitutive activity independent of Δψ)

    • Incorporate unnatural amino acids at key positions to probe function

    • Create fusion proteins with fluorescent tags for localization studies

  • Directed Evolution Strategies:

    • Develop selection systems where S. pombe growth depends on Mrs2 function

    • Create libraries of randomly mutagenized Mrs2

    • Screen for variants with desired properties (e.g., higher transport rates)

    • Use error-prone PCR or DNA shuffling to generate diversity

  • Application of Engineered Mrs2 Variants:

    • Use as tools to study mitochondrial Mg²⁺ homeostasis

    • Create "optogenetic" versions responsive to light for temporal control

    • Develop Mrs2 variants as tools for manipulating mitochondrial Mg²⁺ in vivo

  • Experimental Design for Mrs2 Engineering:

    • Define clear functional parameters to measure

    • Create high-throughput screening methods to assess variants

    • Validate engineered proteins in various genetic backgrounds

    • Characterize biophysical properties using reconstituted systems

These approaches can generate valuable research tools and provide mechanistic insights into Mrs2 function.

How does S. pombe Mrs2 compare to homologs in other organisms?

Comparative analysis reveals evolutionary insights and functional conservation:

  • Cross-Species Comparison Table:

OrganismProtein NameKey Structural FeaturesFunctionPhenotype of Deletion
S. pombeMrs2Two transmembrane domains, F/Y-G-M-N motifMitochondrial Mg²⁺ influxReduced [Mg²⁺]m
S. cerevisiaeMrs2Similar to S. pombe Mrs2Mitochondrial Mg²⁺ influxRespiratory deficiency
HumansMRS2Conserved structureMitochondrial Mg²⁺ channelLinked to various disorders
BacteriaCorAPentameric structure, conserved GMN motifMg²⁺ uptakeGrowth defects in Mg²⁺-limited media
  • Functional Conservation and Divergence:

    • The F/Y-G-M-N motif is conserved across species and critical for function

    • Regulation mechanisms may differ between organisms

    • Interactions with other cellular components can be species-specific

  • Experimental Approaches for Comparative Studies:

    • Heterologous expression of Mrs2 homologs in S. pombe mrs2Δ

    • Domain-swapping between homologs to identify functional regions

    • Parallel phenotypic analysis of deletion mutants across species

    • Structural comparison through homology modeling

This comparative approach provides insights into fundamental aspects of Mg²⁺ transport that are evolutionarily conserved.

What experimental approaches can distinguish between Mrs2 and other mitochondrial transporter functions?

Differentiating Mrs2 function from other transporters requires specific methodologies:

  • Pharmacological Approaches:

    • Use of selective inhibitors:

      • Cobalt(III)hexaammine inhibits Mrs2-mediated transport

      • Compare with inhibitors of other transporters (ruthenium red for MCU, etc.)

    • Dose-response studies to determine inhibitor specificity

    • Competition assays with various cations

  • Genetic Approaches:

    • Create double knockout strains (e.g., mrs2Δ combined with deletions of other transporters)

    • Analyze genetic interactions through synthetic lethality or suppression

    • Use CRISPR-Cas9 for precise genome editing to modify specific residues

  • Transport Specificity Analysis:

    • Measure transport of various ions (Mg²⁺, Ca²⁺, Mn²⁺, Ni²⁺) in isolated mitochondria

    • Compare transport kinetics and dependencies

    • Study competition between different ions

  • In vitro Reconstitution:

    • Purify Mrs2 and reconstitute in liposomes

    • Measure ion flux in a defined system

    • Compare with other reconstituted transporters

These approaches allow researchers to delineate the specific contribution of Mrs2 to mitochondrial ion homeostasis.

What are common technical challenges in Mrs2 research and how can they be addressed?

Researchers face several technical challenges when studying Mrs2:

  • Mitochondrial Isolation Issues:

    • Challenge: Poor yield or damaged mitochondria

    • Solution: Optimize spheroplast formation by adjusting zymolyase concentration and incubation time; use gentler homogenization techniques; include additional protease inhibitors

  • Protein Expression Problems:

    • Challenge: Low expression of recombinant Mrs2

    • Solution: Optimize codon usage for S. pombe; use strong, inducible promoters; add proteasome inhibitors to prevent degradation

  • Functional Assay Limitations:

    • Challenge: Background signal in fluorescence-based Mg²⁺ measurements

    • Solution: Carefully calibrate mag-fura 2 signals; account for autofluorescence; use ratiometric measurements to reduce artifacts

  • Data Interpretation Complexities:

    • Challenge: Distinguishing direct vs. indirect effects of Mrs2 manipulation

    • Solution: Include comprehensive controls; perform time-course experiments; use multiple complementary approaches

  • Troubleshooting Table:

ProblemPossible CausesSolutions
No Mg²⁺ influx in control mitochondriaDamaged mitochondriaCheck membrane potential; optimize isolation
Insufficient dye loadingAdjust mag-fura 2 concentration and loading time
Inactive Mg²⁺ channelsVerify membrane potential; check buffer composition
High background in Mrs2 knockoutIncomplete knockoutVerify deletion by PCR and Western blot
Alternative transport pathwaysUse inhibitors to block other transporters
Variable overexpression resultsPlasmid instabilityCheck plasmid maintenance; use integrative vectors
Toxic effects of overexpressionTitrate expression levels; use inducible promoters

How should researchers optimize experimental conditions for studying Mrs2-mediated Mg²⁺ transport?

Optimization of experimental conditions is crucial for reliable Mrs2 studies:

  • Buffer Composition Optimization:

    • pH: Maintain physiological pH (7.2-7.4) as pH affects Mg²⁺ binding to proteins

    • Ionic strength: Control with KCl (120-150 mM) to maintain native protein conformation

    • Osmolarity: Use sorbitol (0.6 M) to preserve mitochondrial integrity

    • Chelators: Avoid EDTA which binds Mg²⁺; use EGTA for Ca²⁺ chelation only

  • Temperature Considerations:

    • Conduct measurements at physiological temperature (30°C for S. pombe)

    • Maintain stable temperature throughout experiments for consistent transport rates

    • Compare results at different temperatures to calculate activation energy

  • Membrane Potential Modulation:

    • Use respiratory substrates (succinate, NADH) to establish physiological Δψ

    • Apply CCCP to dissipate Δψ as a negative control

    • Titrate valinomycin/K⁺ to set specific Δψ values

  • Mg²⁺ Concentration Range:

    • Test transport over physiologically relevant [Mg²⁺] (0.5-10 mM)

    • Include controls with no added Mg²⁺ to establish baseline

    • Consider free vs. total Mg²⁺ in the presence of ATP or other binding molecules

Careful optimization of these parameters ensures reproducible and physiologically relevant results in Mrs2 transport studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.