Recombinant Schizosaccharomyces pombe Mitochondrial inner membrane protease subunit 2 (SPBC336.13c)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Schizosaccharomyces pombe Mitochondrial Inner Membrane Protease Subunit 2, also known as SPBC336.13c, is a protein component found in the mitochondria of the fission yeast Schizosaccharomyces pombe . SPBC336.13c is an inner membrane protease subunit involved in the proteolytic processing of proteins imported into the mitochondrial matrix .

Schizosaccharomyces pombe as a Model Organism

Schizosaccharomyces pombe is a species of yeast that serves as a valuable model organism for studying various cellular processes . Its utility arises from several factors:

  • Similarity to Mammalian Cells S. pombe shares more similarities with mammalian cells compared to Saccharomyces cerevisiae, particularly in aspects of cell biology .

  • Research Applications It has been instrumental in unraveling the organization of the cytoskeleton, processes of cell division, meiosis, the cell cycle, pre-mRNA splicing, and RNA interference .

  • Disease Research S. pombe has been used to study the molecular basis of human diseases. Approximately 50 of its 4,824 open reading frames exhibit high similarity to human disease genes, some of which are absent in S. cerevisiae .

Mitochondrial Protein Import and Processing

Mitochondria contain numerous proteins that are essential for their function. Most of these proteins are synthesized in the cytoplasm as precursor proteins and then imported into the mitochondria . This import process often involves the removal of transit peptides by proteases, such as SPBC336.13c, in the mitochondrial inner membrane .

Function of SPBC336.13c

SPBC336.13c is involved in catalyzing the removal of transit peptides, which are required for targeting proteins from the mitochondrial matrix across the inner membrane . This proteolytic activity is crucial for the maturation and function of many mitochondrial proteins.

Homology to Other Species

Components of the protein import machinery of S. pombe are evolutionarily related to those of other species, including humans. The table below shows the percentage identity of various S. pombe mitochondrial protein import components with their human orthologues .

ComponentS. pombe orthologueIdentity (%) with human orthologue
Tom70SPAC6B12.1225.9
Tom40SPBC8D22.2225.4
Tom22SPAC17H9.1622.7
Tom20SPAC6F12.0731.5
Tob55SPAC17C9.0631.2
Tim50SPBC8D2.21c30.0
Tim44SPBC14C8.0223.4
Tim23SPCC16A11.09c28.1
Tim22SPBC25H2.04c37.2
Tim21SPBC1289.0919.6
Tim17SPAC3A12.16c46.6
Tim16SPBC713.1037.3
Tim14SPAC824.0644.1
Tim13SPAC17C9.09c44.7
Tim10SPAC222.03c48.1
Tim9SPAC24B10.0540.3
Tim8SPAC13G6.0436.1
Mia40SPAC57A10.11c39.7
Erv1SPAC3G6.0838.9
Mas1SPBP23A10.15c49.5
Mas2SPBC18E5.12c29.2
Oct1SPAC1F3.10c31.1
Oxa1SPAC9G1.0426.9
Hsp70SPAC13G7.02c65.2
Mge1SPBC3B9.1938.1
Mdj1SPCC4G3.1428.8
Hsp60SPAC12G12.0456.4
Hsp10SPCC550.06c43.4

Tandem Proteins in S. pombe Mitochondria

The S. pombe genome contains genes encoding tandem proteins, which include mitochondrial components. These proteins have mitochondrial targeting signals at their N termini, followed by sequences similar to two mitochondrial proteins arranged in tandem . One example is pre-Rsm22-Cox11, which is imported and cleaved in two steps, resulting in three polypeptides: an N-terminal presequence, a mature Rsm22 fragment, and a C-terminal Cox11 protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC336.13c; Mitochondrial inner membrane protease subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC336.13c
Target Protein Sequence
MANPFVRNQSFKSVFFKNLVGITLWVPVLMFVEQHVVSVGTIEGRSMKPAFNPETNMLQR DRVLLWKWNKDYKRGDVVILRSPENPEELLVKRVLGVEYDIMKTRPPKKLSLVPVPEGHV WVEGDEQFHSIDSNKFGPVSTGLITAKVIAILFPFSRAGRIDHEGFRKNAVFLSGKRSVK
Uniprot No.

Target Background

Function
This protein catalyzes the removal of transit peptides necessary for targeting proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space.
Database Links
Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is SPBC336.13c and what is its role in mitochondrial function?

SPBC336.13c encodes the mitochondrial inner membrane protease subunit 2 in Schizosaccharomyces pombe. This protein is localized to the inner mitochondrial membrane and likely functions as part of a proteolytic complex involved in protein processing within the mitochondria. Based on homology to similar proteins in other organisms, it likely participates in the cleavage of targeting sequences from proteins imported into the intermembrane space (IMS) of mitochondria.

Like other mitochondrial proteases, SPBC336.13c may play critical roles in maintaining mitochondrial protein homeostasis by processing newly imported proteins, removing damaged proteins, or regulating the abundance of specific mitochondrial proteins. The protein consists of 180 amino acids and can be recombinantly produced with tags such as His-tags for purification and characterization purposes .

How is SPBC336.13c localized within mitochondria?

SPBC336.13c is anchored in the inner mitochondrial membrane with portions extending into the intermembrane space (IM-IMS). This localization pattern is similar to other mitochondrial proteases like those listed in the comprehensive mitochondrial protein catalog, where proteins such as MGR1 (YCL044C) and MGR3 (YMR115W) are positioned at the IM-IMS interface .

The protein likely contains at least one transmembrane domain that anchors it to the inner membrane, while its catalytic domain faces the intermembrane space. This positioning allows it to process proteins that are translocated across the outer membrane but have not yet been fully imported into the matrix. Subcellular localization can be verified experimentally using techniques such as:

  • Fluorescence microscopy with GFP-tagged SPBC336.13c

  • Immunoelectron microscopy

  • Subcellular fractionation followed by western blotting

  • Protease protection assays to determine topology

What expression systems are most effective for producing recombinant SPBC336.13c?

For efficient production of recombinant SPBC336.13c, E. coli expression systems have been successfully employed to generate His-tagged full-length protein (1-180 amino acids) . When designing expression constructs, researchers should consider:

  • Codon optimization for the host expression system

  • Inclusion of appropriate N-terminal or C-terminal tags for purification

  • Selection of expression vectors with suitable promoters for regulated expression

  • Growth conditions that maximize protein solubility and proper folding

The Creative BioMart catalog indicates successful production of His-tagged SPBC336.13c in E. coli, suggesting this system is viable for generating research quantities of the protein . For structural studies or enzymatic assays, further optimization may be required to ensure the recombinant protein retains its native conformation and activity.

How does SPBC336.13c compare to homologous proteins in other organisms?

SPBC336.13c belongs to a conserved family of mitochondrial inner membrane proteases found across eukaryotes. While the search results don't provide direct comparative information, we can infer from mitochondrial protease research that SPBC336.13c likely shares functional and structural similarities with:

  • Imp2 in Saccharomyces cerevisiae

  • IMMP2L in humans

  • Similar proteases in other model organisms

These homologous proteins typically function in processing proteins that use the "stop-transfer" import pathway, where proteins with bipartite targeting signals are first directed toward the matrix via the TOM-TIM23 pathway, then arrested at the inner membrane and potentially released into the IMS after processing .

Researchers investigating SPBC336.13c should perform sequence alignments, phylogenetic analyses, and functional complementation studies to establish the degree of conservation and functional equivalence between this protein and its homologs.

What are the known substrates of SPBC336.13c and how can they be systematically identified?

  • Reside in the intermembrane space

  • Are anchored to the inner membrane

  • Require proteolytic processing for maturation or activation

To systematically identify substrates, researchers could employ the following methodologies:

  • Comparative proteomics: Compare the mitochondrial proteome of wild-type and SPBC336.13c deletion strains to identify proteins that accumulate as unprocessed precursors in the mutant.

  • Substrate trapping: Create catalytically inactive mutants of SPBC336.13c that can bind but not cleave substrates, then identify trapped proteins by mass spectrometry.

  • In vitro cleavage assays: Test candidate substrates with purified recombinant SPBC336.13c protease.

  • Bioinformatic prediction: Analyze mitochondrial proteins for consensus cleavage motifs based on known substrates of homologous proteases.

This approach might be facilitated by tools like the "Query using substrate genes" feature being developed for PomBase, which could potentially allow researchers to identify and filter substrate genes for molecular functions .

What methodologies are most effective for studying SPBC336.13c function in vivo?

To investigate the biological function of SPBC336.13c in vivo, researchers can employ several complementary approaches:

  • Gene deletion/mutation studies: Create SPBC336.13c knockout or conditional mutants and assess phenotypes related to mitochondrial function, cellular respiration, and growth under various conditions.

  • Fluorescence microscopy: Use tagged versions of SPBC336.13c to monitor its localization and potential redistribution under different cellular conditions.

  • Genetic interaction screens: Identify synthetic lethal or synthetic sick interactions with other genes to map the functional network of SPBC336.13c.

  • Suppressor screens: Identify genes that when overexpressed or mutated can suppress phenotypes associated with SPBC336.13c deletion.

  • Metabolomic analysis: Assess changes in cellular metabolism resulting from SPBC336.13c dysfunction.

These approaches can reveal the cellular processes dependent on SPBC336.13c function and place this protease within the broader context of mitochondrial protein homeostasis.

How can the protease activity of SPBC336.13c be measured in vitro?

Characterizing the enzymatic activity of SPBC336.13c requires careful experimental design and consideration of its native environment. Researchers can develop in vitro assays using:

  • Fluorogenic peptide substrates: Design peptides containing fluorophore/quencher pairs that increase fluorescence upon cleavage.

  • Recombinant substrate processing: Express and purify potential substrate proteins and monitor their processing by purified SPBC336.13c using SDS-PAGE and western blotting.

  • Mass spectrometry: Identify precise cleavage sites by analyzing substrate fragments after protease treatment.

  • Kinetic measurements: Determine enzyme kinetics (Km, Vmax) under varying conditions to understand substrate specificity and catalytic efficiency.

Important considerations for in vitro assays include:

  • Buffer composition mimicking the mitochondrial intermembrane space

  • pH optimization (likely in the 7.0-8.0 range)

  • Potential cofactor requirements

  • Detergent selection for solubilizing the membrane-associated protease

  • Temperature (30°C is standard for S. pombe proteins)

What protein complexes does SPBC336.13c participate in and how can these interactions be characterized?

SPBC336.13c likely functions as part of a multiprotein complex similar to other mitochondrial proteases. To characterize these interactions, researchers can employ:

  • Affinity purification coupled with mass spectrometry: Tag SPBC336.13c with an affinity tag, purify under native conditions, and identify co-purifying proteins.

  • Yeast two-hybrid screens: Identify direct protein-protein interactions using SPBC336.13c as bait.

  • Co-immunoprecipitation: Validate specific interactions using antibodies against candidate interacting proteins.

  • Blue native PAGE: Resolve intact protein complexes containing SPBC336.13c to determine their molecular weight and composition.

  • Proximity labeling: Use BioID or APEX2 fusions to SPBC336.13c to identify proteins in close proximity in vivo.

Based on patterns observed with other mitochondrial proteases like the i-AAA protease components (MGR1, MGR3), SPBC336.13c may interact with other proteins to form a functional complex capable of recognizing and processing specific substrates .

How does SPBC336.13c function compare to its role in mitochondrial proteostasis networks?

SPBC336.13c likely contributes to broader mitochondrial proteostasis networks that maintain protein quality control in this organelle. Understanding its position in these networks requires integration of multiple approaches:

  • System-wide analysis: Compare phenotypes of SPBC336.13c mutants with those of other mitochondrial proteases (e.g., YME1 homologs) to identify unique and overlapping functions .

  • Stress response studies: Examine how SPBC336.13c responds to various mitochondrial stresses such as oxidative damage, protein misfolding, or respiratory chain dysfunction.

  • Double mutant analysis: Create strains lacking multiple proteases to identify compensatory mechanisms and functional redundancy.

  • Conditional regulation: Develop systems to conditionally activate or inactivate SPBC336.13c to study acute versus chronic effects of its loss.

What are the optimal conditions for expressing and purifying functional recombinant SPBC336.13c?

For successful expression and purification of functional SPBC336.13c, researchers should consider:

  • Expression system selection: E. coli has been successfully used for recombinant production of His-tagged SPBC336.13c . Alternative systems like yeast or insect cells might provide better folding for functional studies.

  • Solubilization strategies: As a membrane protein, SPBC336.13c requires appropriate detergents for extraction and maintenance of its native conformation. Common options include:

    • Mild detergents like DDM or LMNG

    • Amphipols or nanodiscs for maintaining membrane environment

    • Detergent screening to identify optimal conditions

  • Purification approach:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Size exclusion chromatography for final polishing

    • Activity-based validation at each purification step

  • Buffer optimization:

    • pH range appropriate for maintaining stability (typically 7.0-8.0)

    • Salt concentration that prevents aggregation

    • Reducing agents to maintain cysteine residues

    • Glycerol or other stabilizing agents

A comprehensive purification strategy would include quality control steps to verify protein integrity, folding status, and enzymatic activity throughout the process.

What analytical methods are most suitable for characterizing SPBC336.13c structure and function?

Multiple analytical approaches can provide insights into SPBC336.13c structure and function:

  • Structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for complex structure determination

    • Circular dichroism to assess secondary structure content

    • NMR for dynamic regions or smaller domains

  • Functional characterization:

    • Protease activity assays using fluorogenic substrates

    • Site-directed mutagenesis to identify catalytic residues

    • Chemical crosslinking to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Biophysical analysis:

    • Thermal shift assays to evaluate protein stability

    • Microscale thermophoresis for measuring binding affinities

    • Surface plasmon resonance for interaction kinetics

Integrating multiple analytical methods provides a comprehensive understanding of both structure and function, allowing researchers to connect specific structural features to their roles in protease activity.

How can genetic manipulation techniques be optimized for studying SPBC336.13c in S. pombe?

S. pombe offers several genetic tools for studying SPBC336.13c function:

  • CRISPR-Cas9 genome editing: For precise modifications including:

    • Gene deletion

    • Point mutations to disrupt specific functions

    • Insertion of epitope tags

    • Creation of conditional alleles

  • Homologous recombination strategies:

    • Replacement of endogenous SPBC336.13c with mutant versions

    • Integration of regulatory elements for controlled expression

    • Creation of fusion proteins for localization studies

  • Expression systems:

    • Repressible/inducible promoters (nmt1) for controlled expression

    • Integration at neutral loci for complementation studies

    • Plasmid-based expression for high-throughput screening

  • Phenotypic analysis:

    • Growth assays under various conditions

    • Mitochondrial morphology and function assessment

    • Genetic interaction screening using synthetic genetic arrays

Researchers studying mating-type switching in S. pombe have successfully employed gene deletion libraries to screen for phenotypes, an approach that could be adapted to study SPBC336.13c function in mitochondrial contexts .

How can high-throughput approaches be used to place SPBC336.13c in the context of global mitochondrial function?

Integrating SPBC336.13c research into broader mitochondrial studies requires sophisticated approaches:

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Map changes across multiple cellular compartments

    • Identify regulatory networks affected by SPBC336.13c disruption

  • Comparative analysis across species:

    • Analyze functional conservation with homologs in other organisms

    • Identify species-specific adaptations in mitochondrial protease systems

    • Leverage insights from model systems with more extensively characterized mitochondrial processes

  • Network analysis:

    • Construct protein-protein interaction networks centered on SPBC336.13c

    • Identify hub proteins and functional modules

    • Map genetic interactions to biochemical pathways

  • Evolutionary analysis:

    • Trace the evolutionary history of SPBC336.13c across fungal lineages

    • Identify conserved domains and sequence motifs

    • Correlate structural conservation with functional importance

These integrative approaches can reveal unexpected connections between SPBC336.13c and broader cellular processes, potentially identifying novel functions or regulatory mechanisms.

What computational tools can predict SPBC336.13c substrates and interaction partners?

Several computational approaches can generate testable hypotheses about SPBC336.13c function:

  • Substrate prediction:

    • Motif-based analysis of potential cleavage sites

    • Structural modeling of enzyme-substrate complexes

    • Machine learning approaches trained on known mitochondrial protease substrates

  • Protein-protein interaction prediction:

    • Coevolution analysis to identify interaction surfaces

    • Docking simulations with candidate partners

    • Text mining of literature for implicated interactions

  • Functional association networks:

    • Gene co-expression analysis across conditions

    • Phylogenetic profiling to identify functionally linked genes

    • Integration of high-throughput genetic interaction data

  • Structural prediction:

    • Homology modeling based on related proteases

    • Prediction of transmembrane domains and topology

    • Molecular dynamics simulations to explore conformational states

These computational predictions should guide experimental design, creating a cycle of prediction, validation, and refinement that accelerates research progress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.