Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitochondria, essential organelles in eukaryotic cells, contain an intermembrane space (IMS) that houses a variety of proteins crucial for various cellular processes . The import and assembly of these proteins are facilitated by specific machineries, one of which involves the protein Mia40 . Mia40 is a vital component of the protein import system in the mitochondrial IMS . It is responsible for the import of nuclear-encoded precursor proteins into the four different subcompartments of the mitochondria .

Discovery and Function of Mia40

Mia40, initially identified in Saccharomyces cerevisiae, is an essential IMS protein . It facilitates the import of small Tim proteins, which are themselves essential for cell viability . Research has demonstrated that Mia40 is central to the protein import and assembly machinery of the mitochondrial IMS .

Role in Protein Import

Mia40 is essential for the import of precursor proteins into the IMS . Studies using mutant strains of Mia40 have shown that the protein is required for the biogenesis of small Tim proteins . Mia40 binds to incoming unfolded precursor proteins and promotes their translocation into the IMS .

Mia40 as a Trans-Site Receptor

Mia40 functions as a 'trans-site receptor,' where hydrophobic binding to incoming polypeptides drives protein import into the mitochondrial IMS . This trapping activity of Mia40 is essential for protein import .

Mia40 and Hot13 Interaction

The zinc-binding protein Hot13 interacts functionally and physically with Mia40 and improves Erv1-dependent oxidation of Mia40 substrates .

Mia40 in Different Organisms

In fungi, Mia40 is synthesized as a large protein with an N-terminal presequence, while in metazoans and plants, Mia40 consists only of the conserved C-terminal domain . Human Mia40 and the C-terminal domain of yeast Mia40 can rescue Mia40-deficient yeast, demonstrating that Mia40 contains dual targeting information .

Diseases Linked to IMS Proteins

Many IMS proteins are linked to human diseases, making it crucial to understand how they reach their site of function in the IMS .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mia40; tim40; SPAC57A10.11c; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
62-313
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mia40
Target Protein Sequence
AASLTAGYLLGKNTSNASSSQDNDHPVVGEHVHTETQSYNEPYMQRHRIEDAIEKKMTSE TQPSTDEKGRKVSATENSAPKKTDKEKSSGETAGNILREQIATGKDDDEYARKFEEVEEE SSEESAFNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSKSEPKGMECLDKFQAMQ ACFQKHPEIYQDMVGESEEEDAETNEKPSTTSDENNQPQSPPSDNASNPEEDVMNMEKEI VNLTPMSVIKEI
Uniprot No.

Target Background

Function

Function: MIA40 is essential for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are imported in their reduced state. Oxidized MIA40 forms a transient disulfide bond with the reduced precursor, oxidizing the precursor protein. This allows the formation of an intramolecular disulfide bond within the precursor, enabling its proper folding within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is the fundamental role of Mia40 in mitochondrial function?

Mia40 functions as a central component of the protein import and assembly machinery in the mitochondrial intermembrane space (IMS). It plays an essential role in the biogenesis of small IMS proteins, particularly those containing characteristic cysteine motifs. Experimentally, Mia40 has been shown to bind incoming unfolded precursor proteins as they translocate across the outer membrane, facilitating their complete translocation into the IMS and promoting their assembly into functional complexes. Studies with mutant mitochondria demonstrate that when Mia40 function is impaired, the import of several small IMS proteins, including the essential proteins Tim9 and Tim10, is selectively inhibited, while the import of proteins to other mitochondrial compartments remains unaffected . This selective inhibition confirms Mia40's specialized role in IMS protein biogenesis rather than general mitochondrial protein import.

How does the structure of S. pombe Mia40 compare to its homologs in other species?

While the search results don't provide specific structural information about S. pombe Mia40, comparative studies between fungal and human Mia40 reveal important structural differences that can inform research on S. pombe Mia40. In fungi like Saccharomyces cerevisiae, Mia40 is synthesized as a larger protein (approximately 40 kDa) with an N-terminal presequence and a hydrophobic segment that anchors it to the inner membrane . In contrast, metazoan and plant MIA40 consists only of the conserved C-terminal domain (approximately 16 kDa) and functions as a soluble protein in the IMS .

Based on these patterns, S. pombe Mia40 likely shares the fungal characteristic of having an N-terminal presequence, but researchers should experimentally verify this through sequence analysis and import studies. Importantly, functional studies have demonstrated that the C-terminal domain of yeast Mia40 (termed Mia40core, residues 226-403 in S. cerevisiae) is sufficient for substrate binding and can rescue the viability of Mia40-deficient yeast . This suggests that when working with recombinant S. pombe Mia40, researchers could consider expressing both the full-length protein and the core domain for comparative functional studies.

What are the key substrate proteins recognized by Mia40?

Mia40 primarily recognizes and facilitates the import of small cysteine-rich proteins destined for the intermembrane space. The best-characterized substrates include:

  • Small Tim proteins (Tim8, Tim9, Tim10, Tim13) - These are essential components of the mitochondrial protein import machinery that function as chaperones for hydrophobic membrane proteins

  • Cox17 and other proteins involved in copper delivery for cytochrome c oxidase assembly

  • Other small IMS proteins containing characteristic cysteine motifs

When investigating Mia40 function in S. pombe, researchers should prioritize examining its interaction with these conserved substrate proteins. Experimental approaches for studying these interactions include co-immunoprecipitation assays with tagged versions of Mia40 and its substrates, followed by non-reducing SDS-PAGE to preserve disulfide-linked Mia40-substrate conjugates . In vitro binding assays using purified recombinant Mia40 (either full-length or core domain) incubated with radiolabeled precursor proteins can quantitatively measure substrate binding efficiency, as demonstrated with Tim9 precursors .

What expression systems are optimal for producing recombinant S. pombe Mia40?

Based on successful approaches with S. cerevisiae Mia40, recombinant S. pombe Mia40 can be expressed in E. coli systems. For full experimental control, researchers should consider expressing both:

  • Full-length S. pombe Mia40 - Including the N-terminal presequence and membrane-anchoring segment

  • Mia40core domain - Comprising only the conserved C-terminal region with the characteristic cysteine residues

When expressing in E. coli, attention must be paid to the redox environment since Mia40 contains critical disulfide bonds. Expression protocols should include:

  • Induction at lower temperatures (16-20°C) to promote proper folding

  • Use of E. coli strains engineered for disulfide bond formation (e.g., Origami, SHuffle)

  • Inclusion of oxidizing agents in the growth medium or lysis buffer

  • Purification under non-reducing conditions to maintain native disulfide bonds

For functional assays, researchers should verify that recombinant Mia40 can form conjugates with substrate proteins such as Tim9. As demonstrated with S. cerevisiae Mia40core, incubation with 35S-labeled precursor of Tim9 should result in Mia40-Tim9 conjugates detectable by non-reducing SDS-PAGE .

How can researchers effectively study the import pathway of Mia40 itself?

Mia40 presents a unique opportunity to study dual import pathways in mitochondria. In fungi, full-length Mia40 with its N-terminal presequence is imported via the presequence pathway in a membrane potential (Δψ)-dependent manner, while the Mia40core domain can be imported via the MIA pathway . To study these pathways in S. pombe:

Methodology for studying Mia40 import:

  • Prepare radiolabeled ([35S]-methionine) versions of both full-length Mia40 and Mia40core through in vitro translation

  • Isolate intact mitochondria from S. pombe through differential centrifugation

  • Perform in vitro import assays under varying conditions:

    • With/without membrane potential (using CCCP to dissipate Δψ)

    • In mitochondria with depleted or mutated components of either import pathway

    • At different temperatures to modify import kinetics

  • Analyze import by SDS-PAGE and autoradiography, monitoring:

    • Processed (mature) form appearing over time (indicating presequence cleavage)

    • Resistance to protease treatment (indicating complete import)

    • Formation of disulfide-linked intermediates (visible on non-reducing gels)

  • For Mia40core import, perform import assays in wild-type mitochondria versus mitochondria depleted of endogenous Mia40 or Erv1 (components of the MIA pathway)

This dual import capability may represent an evolutionary adaptation and provides a valuable experimental system for studying the evolution of mitochondrial import pathways .

What techniques can be used to monitor the redox state of Mia40?

Since Mia40 functions through cycles of oxidation and reduction of its cysteine residues, monitoring its redox state is crucial. Recommended techniques include:

  • AMS/NEM alkylation assay:

    • Treat isolated mitochondria or purified Mia40 with N-ethylmaleimide (NEM) to block free thiols

    • Reduce with DTT and then treat with 4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid (AMS)

    • Analyze by SDS-PAGE to detect mobility shifts (AMS adds ~0.5 kDa per modified cysteine)

  • Redox Western blotting:

    • Prepare samples under non-reducing conditions

    • Separate by SDS-PAGE and detect Mia40 by immunoblotting

    • Compare mobility patterns to identify oxidized vs. reduced forms and mixed disulfides with partner proteins

  • Diagonal redox 2D gel electrophoresis:

    • Separate proteins under non-reducing conditions in the first dimension

    • Reduce the gel strip and run in a second dimension under reducing conditions

    • Proteins that formed disulfide bonds will appear off the diagonal

  • Mass spectrometry of alkylated samples:

    • Alkylate free thiols with one agent (e.g., NEM)

    • Reduce and alkylate previously oxidized thiols with a different agent (e.g., iodoacetamide)

    • Digest and analyze by MS to identify specific cysteine residues involved in disulfide bonds

These methods can reveal the dynamic redox state of Mia40 during the import process and its interactions with substrate proteins and the sulfhydryl oxidase Erv1.

How does Mia40 interact with the apoptosis-inducing factor (AIF) and what are the functional implications?

Recent research has uncovered a physical interaction between Mia40 and AIF that has significant implications for mitochondrial function. AIF deficiency correlates with decreased Mia40 protein levels without affecting mRNA transcription, suggesting post-transcriptional regulation .

Experimental approaches to study the Mia40-AIF interaction:

  • Co-immunoprecipitation assays:

    • Immunoprecipitate endogenous AIF and probe for Mia40 co-precipitation

    • Perform the reverse experiment by immunoprecipitating Mia40

    • As shown in published data, both approaches confirm physical binding between the proteins

  • Domain mapping:

    • Generate mutant AIF constructs lacking specific domains

    • Perform co-immunoprecipitation assays to identify critical binding regions

    • Research indicates that the transmembrane domain (residues 66-86) is critical for AIF binding to MIA40

  • Functional rescue experiments:

    • In AIF-deficient cells (such as those from Harlequin mutant mice or patient-derived fibroblasts), overexpress MIA40

    • Assess whether increased MIA40 levels can counteract the loss of respiratory subunits

    • Evidence suggests MIA40 overexpression can partially rescue respiratory defects in AIF-deficient cells

This interaction provides a potential mechanistic link between AIF deficiency and impaired oxidative phosphorylation, which may be relevant for developing therapeutic approaches for AIF-related mitochondrial disorders. When studying S. pombe Mia40, researchers should investigate whether this interaction with AIF is conserved and what role it plays in fission yeast mitochondrial function.

What role does Mia40 play in the assembly of respiratory complexes?

While Mia40 directly facilitates the import and folding of small IMS proteins, it indirectly impacts the assembly of respiratory complexes. The connection appears to involve:

  • Mia40-dependent import of critical assembly factors for respiratory complexes

  • Interactions with AIF that affect the maintenance of respiratory subunits

  • The proper folding and assembly of small Tim proteins, which function as chaperones for the import of respiratory complex subunits

Experimental approaches to study this function:

  • BN-PAGE analysis of respiratory complexes:

    • Isolate mitochondria from wild-type and Mia40-depleted cells

    • Solubilize with mild detergents (digitonin) to preserve complex integrity

    • Separate by blue native PAGE and immunoblot for subunits of each respiratory complex

    • Compare complex assembly patterns and identify specific defects

  • Pulse-chase experiments:

    • Label newly synthesized proteins with [35S]-methionine

    • Chase with unlabeled methionine for various time periods

    • Isolate mitochondria and analyze respiratory complex assembly by BN-PAGE

    • Compare assembly kinetics between wild-type and Mia40-mutant cells

  • Complementation studies:

    • Express different forms of Mia40 (full-length, core domain, mutated versions) in Mia40-depleted cells

    • Assess rescue of respiratory complex assembly by BN-PAGE and enzyme activity assays

    • This approach can identify which domains of Mia40 are critical for respiratory complex assembly

Which domains and residues of Mia40 are critical for its different functions?

Mia40 possesses several functional domains that contribute to its diverse roles. Based on studies of yeast Mia40, critical elements include:

Functional domains of Mia40:

  • N-terminal presequence (in fungal Mia40):

    • Directs import via the presequence pathway

    • Is proteolytically removed in the matrix

  • Hydrophobic segment (in fungal Mia40):

    • Arrests translocation in the inner membrane

    • Anchors the mature protein to the inner membrane

  • C-terminal core domain (conserved in all species):

    • Contains the substrate binding site

    • Houses the redox-active CPC (cysteine-proline-cysteine) motif

    • Contains structural disulfide bonds

    • Sufficient for Mia40 function in vivo

Experimental approaches to identify critical residues:

  • Site-directed mutagenesis:

    • Generate point mutations of conserved residues, particularly cysteines

    • Express in Mia40-depleted yeast and assess complementation

    • Analyze import function using in vitro assays with radiolabeled substrates

  • Domain swapping experiments:

    • Create chimeric proteins between S. pombe Mia40 and homologs from other species

    • Express in Mia40-depleted cells and assess functional complementation

    • This approach can identify species-specific functional elements

  • Limited proteolysis:

    • Treat purified Mia40 with controlled amounts of proteases

    • Identify stable fragments by SDS-PAGE and mass spectrometry

    • These fragments likely represent structured domains important for function

Studies with recombinant Mia40 have demonstrated that the C-terminal domain (Mia40core) is capable of binding substrate proteins with efficiency comparable to the full-length protein , highlighting the functional importance of this conserved region.

What experimental approaches can be used to study the dual import pathways of Mia40?

The discovery that yeast Mia40 contains dual targeting information, directing the large precursor to the presequence pathway and the smaller Mia40core to the MIA pathway , provides a unique experimental system for studying mitochondrial import pathways.

Methods to analyze dual import pathways:

  • In vitro import assays with pathway inhibitors:

    Import PathwayInhibitorEffect on Mia40 Import
    Presequence pathwayCCCP (dissipates Δψ)Blocks import of full-length Mia40
    MIA pathwayDepletion of endogenous Mia40 or Erv1Inhibits import of Mia40core
    TOM complexAntibodies against Tom receptorsAffects both pathways
  • Genetic approach using yeast strains with conditional mutations:

    • Temperature-sensitive mutants in components of either pathway

    • Analyze import of full-length Mia40 versus Mia40core at permissive and restrictive temperatures

    • This approach can identify specific components required for each pathway

  • In vivo dual expression system:

    • Express both full-length Mia40 and Mia40core in the same cells

    • Use different tags or epitopes to distinguish the proteins

    • Monitor their localization, import kinetics, and interaction with import machinery components

    • This approach mimics the experimental system described in the research literature

  • Chimeric protein approach:

    • Create fusion proteins with targeting signals from different pathways

    • Analyze their import routes and efficiency

    • This can help identify minimal targeting sequences for each pathway

These experimental approaches not only provide insights into Mia40 biogenesis but also serve as tools for studying the evolution of mitochondrial protein sorting pathways.

What are common pitfalls in recombinant Mia40 expression and purification?

Researchers working with recombinant S. pombe Mia40 should be aware of several challenges:

  • Unusual migration on SDS-PAGE:

    • Mia40 migrates significantly more slowly on SDS-PAGE than expected based on molecular weight

    • This behavior is characteristic of highly acidic proteins due to reduced binding of SDS

    • Researchers should use molecular weight markers alongside purified Mia40 standards for accurate identification

  • Abnormal behavior on blue native electrophoresis:

    • Mia40 exhibits unusual mobility on BN-PAGE, migrating in the 150-180 kDa range even under conditions that should dissociate complexes

    • This is likely due to reduced binding of the negatively charged Coomassie blue dye

    • Alternate techniques like size exclusion chromatography should be used to determine the true oligomeric state

  • Maintaining the correct redox state:

    • Mia40 contains critical disulfide bonds essential for function

    • Expression and purification should maintain these bonds

    • Include oxidizing agents and avoid reducing agents during purification

    • Monitor disulfide bond formation by non-reducing SDS-PAGE or AMS modification assays

  • Low solubility or aggregation:

    • If expressing full-length S. pombe Mia40, the hydrophobic membrane-anchoring segment may cause aggregation

    • Consider using detergents during purification or express only the soluble core domain

    • Trial different solubilization conditions (detergents, salt concentrations, pH)

When troubleshooting purification issues, researchers can verify the identity and integrity of purified Mia40 by demonstrating its ability to form conjugates with substrate proteins such as Tim9, as this functional assay confirms that the protein is correctly folded .

How can researchers distinguish between direct and indirect effects of Mia40 depletion?

When working with Mia40-depleted systems, it can be challenging to distinguish primary defects directly caused by Mia40 absence from secondary consequences:

Methodological approaches to distinguish effects:

  • Time-course experiments:

    • Use inducible depletion systems (e.g., tetracycline-regulated expression)

    • Monitor multiple parameters at different time points after initiating depletion

    • Early effects are more likely to be direct consequences of Mia40 depletion

  • Substrate-specific assays:

    • Focus on known direct Mia40 substrates (e.g., small Tim proteins)

    • Compare their import, folding, and assembly to proteins that are not Mia40 substrates

    • Direct effects should primarily impact Mia40 substrates

  • Rescue experiments with specific variants:

    • Express different Mia40 variants (wild-type, substrate-binding mutants, etc.)

    • Assess which defects are rescued by which variants

    • This approach can link specific Mia40 functions to observed phenotypes

  • Comparative analysis across species:

    • Compare phenotypes of Mia40 depletion in S. pombe with those in S. cerevisiae and other systems

    • Conserved effects are more likely to represent direct consequences of core Mia40 function

  • In vitro reconstitution:

    • Develop in vitro systems with purified components to reconstitute Mia40-dependent processes

    • This approach allows direct testing of mechanistic hypotheses without cellular complexity

For instance, studies in yeast demonstrated that mutant protein Mia40-3 is specifically impaired in its interaction with precursors of small Tim proteins, resulting in inhibited translocation into the IMS and hindered assembly into mature TIM complexes . This direct connection between Mia40 function and specific substrate processing helps distinguish primary from secondary effects.

What do the structural differences between fungal and metazoan Mia40 suggest about evolutionary adaptation?

The structural differences between fungal Mia40 (larger, with N-terminal presequence) and metazoan MIA40 (smaller, composed only of the core domain) provide insights into evolutionary adaptation of protein import pathways:

Evolutionary implications to investigate:

  • Simplification of the import pathway:

    • The metazoan MIA40 represents a more streamlined version, potentially allowing for more efficient import

    • Research question: Does the smaller size of metazoan MIA40 correlate with different kinetics or capacity of the MIA pathway?

  • Adaptation to different cellular environments:

    • The inner membrane anchoring of fungal Mia40 may reflect adaptation to specific physiological conditions

    • Research question: How does membrane anchoring versus soluble localization affect the function and substrate specificity of Mia40?

  • Co-evolution with interaction partners:

    • Differences in Mia40 structure may reflect co-evolution with other components of the import machinery

    • Research question: Are there corresponding differences in Erv1/ALR or substrate proteins between fungi and metazoans?

  • Experimental approaches for evolutionary studies:

    • Create chimeric proteins between fungal and metazoan Mia40

    • Express metazoan MIA40 in fungi and vice versa

    • Analyze complementation efficiency and functional equivalence

Research has shown that human MIA40 can rescue the viability of Mia40-deficient yeast, demonstrating functional conservation despite structural differences . Similarly, the C-terminal domain of yeast Mia40 (Mia40core) is sufficient for function in vivo . These findings suggest that the core domain represents the evolutionarily conserved functional unit, while the N-terminal extension in fungi may represent a lineage-specific adaptation.

S. pombe, being evolutionarily distant from S. cerevisiae but still a fungal species, provides an excellent model for investigating these evolutionary questions. Comparative studies between S. pombe Mia40, S. cerevisiae Mia40, and human MIA40 could reveal evolutionary patterns in mitochondrial import systems.

What emerging technologies could advance our understanding of Mia40 function?

Several cutting-edge technologies hold promise for deeper insights into Mia40 biology:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of Mia40-substrate complexes

    • Visualize the dynamic interaction between Mia40, substrates, and Erv1

    • This could reveal the structural basis of substrate recognition and disulfide exchange

  • Single-molecule techniques:

    • FRET-based approaches to monitor Mia40-substrate interactions in real-time

    • Optical tweezers to study the force generation during protein translocation

    • These techniques could provide insights into the kinetics and mechanics of import

  • Genome-wide CRISPR screens:

    • Identify genetic interactions with Mia40

    • Discover new components of the MIA pathway

    • Uncover unexpected connections to other cellular processes

  • In-cell NMR spectroscopy:

    • Monitor the redox state and structural changes of Mia40 within living cells

    • Observe interactions with substrates in the native environment

    • This could reveal previously unknown dynamic aspects of Mia40 function

  • Proteomics approaches:

    • Quantitative proteomics to identify the complete set of Mia40 substrates

    • Redox proteomics to monitor global changes in protein oxidation state upon Mia40 manipulation

    • These approaches could reveal the full scope of Mia40's impact on cellular function

How might understanding Mia40 function contribute to mitochondrial disease research?

The discovery of the interaction between Mia40 and AIF, and the observation that MIA40 overexpression can counteract some effects of AIF deficiency , suggests potential therapeutic applications of Mia40 research:

Potential research directions:

  • Characterization of Mia40 in disease models:

    • Analyze Mia40 levels and function in cellular and animal models of mitochondrial diseases

    • Assess whether Mia40 dysfunction contributes to pathology

    • Determine if Mia40 upregulation could be protective

  • Development of therapeutic approaches:

    • Design strategies to increase Mia40 levels or enhance its function

    • Screen for small molecules that stabilize Mia40 or promote its activity

    • Explore gene therapy approaches to express optimized versions of Mia40

  • Biomarker development:

    • Investigate whether Mia40 levels or oxidation state could serve as biomarkers for mitochondrial dysfunction

    • Develop assays to monitor Mia40 function in patient samples

  • Connection to oxidative stress pathways:

    • Explore how Mia40 function intersects with cellular responses to oxidative stress

    • Investigate potential protective roles of Mia40 against oxidative damage

Understanding the fundamental biology of Mia40 in model systems like S. pombe can provide insights that ultimately contribute to understanding and treating human mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.