Recombinant Schizosaccharomyces pombe Mitochondrial metalloendopeptidase OMA1 (oma1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Schizosaccharomyces pombe Mitochondrial Metalloendopeptidase OMA1 (oma1) is a critical metalloprotease involved in mitochondrial quality control and stress response . OMA1 is located in the inner mitochondrial membrane and participates in the regulation of mitochondrial dynamics, including fusion and fission, which are essential for maintaining mitochondrial function and cellular homeostasis .

OMA1 Function and Structure

OMA1 is an ATP-independent metalloproteinase encoded by the OMA1 gene . It functions as part of the quality control system within the inner mitochondrial membrane . The protein comprises a matrix-facing N-terminal domain, a transmembrane domain, and a catalytic domain . OMA1 belongs to the zinc metallopeptidase family . It regulates mitochondrial morphology and helps cells adapt to metabolic changes and remove damaged organelles .

Role in Mitochondrial Dynamics

Mitochondria undergo continuous fusion and fission, allowing cells to manage metabolic adaptations and eliminate damaged organelles . OMA1 influences these processes by cleaving target proteins such as OPA1 .

  • OPA1 Cleavage: OMA1-mediated cleavage of OPA1 at the S1 site leads to mitochondrial fission and the integrated stress response . OPA1 is necessary for inner membrane fusion, and its cleavage by OMA1 results in the generation of short, inactive S-OPA1 isoforms .

  • MICOS Complex: OMA1 and OPA1 are components of the mitochondrial contact site and crista organizing system (MICOS), which regulates crista structure . The absence of OMA1 can reduce the stability of the MICOS complex .

OMA1 Activation and Regulation

OMA1 activation is tightly regulated and involves both proteolytic and autocatalytic processes that result in the production of enzymatically active OMA1 protein isoforms .

  • Stress-Induced Activation: Upon mitochondrial depolarization or oxidative stress, OMA1 is activated, leading to the cleavage of target proteins, including OPA1 and DELE1 . This activation provokes mitochondrial fission and an integrated stress response .

  • Redox-Sensing Site: A redox-sensing site within OMA1 is crucial for its activation upon mitochondrial depolarization and oxidative stress . In yeast, this regulation depends on the formation of a disulfide bridge between specific cysteine residues, contributing to the electron transport chain's organization and function .

OMA1 and Disease

Aggressive tumors often exhibit mitochondrial dysfunction . Given OMA1's role in mitochondrial stress response, it is implicated in cancer development .

  • Tumor Development: Research indicates that OMA1 function is linked to tumor development. For instance, a mutation in the OMA1 cysteine 403 residue in mouse sarcoma cells impaired mitochondrial responses to stress, reducing ATP production and promoting resistance to apoptosis .

  • Potential Therapeutic Target: Interrupting OMA1 function in cancer cells may interfere with stress response pathways and enhance cancer cell death, suggesting OMA1 as a potential therapeutic target .

Research Findings

FindingDescriptionReference
OMA1 Redox SiteCysteine 403 in mammalian OMA1 may act as a redox sensor similar to yeast OMA1.
OPA1 CleavageActivated OMA1 cleaves L-OPA1 at the S1 site, producing short, inactive S-OPA1 isoforms.
Impact on Mitochondrial DynamicsOMA1 influences mitochondrial fusion and fission processes, which are crucial for cellular adaptation and removal of damaged organelles.
Effect on MICOS ComplexThe absence of OMA1 can reduce the stability of the MICOS complex, which is involved in organizing crista structure.
Stress ResponseOMA1 is activated upon mitochondrial depolarization or oxidative stress, leading to the cleavage of OPA1 and DELE1, triggering mitochondrial fission and stress response.
Implications for Tumor DevelopmentMutations in OMA1 can impair mitochondrial stress responses and affect tumor development, suggesting its potential as a therapeutic target.
Recombinant OMA1 Cleavage SpecificityRecombinant OMA1 protein can cleave artificial substrates based on OPA1 peptides, but the specificity of this cleavage has been questioned.
OMA1 Mutation Effects on Mitochondrial FunctionMutation of cysteine 403 to alanine in OMA1 impairs mitochondrial responses to stress, including ATP production, mitochondrial fission, and apoptosis resistance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
oma1; SPAP14E8.04; Mitochondrial metalloendopeptidase OMA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
Target Protein Sequence
MFLNKYISNYSRTRAVSCAPVLSYKKCSYRNFNGLLQARFQSNNLSWSNRNRVVYKSFQP NPRDKRFQWIFGALIAGGGVYYFTHLEYVPISNRRRFNDVSLDFEKRMAQDAYKEVMSEY GDRMLPSYHPTTLYVSRVLKRIIAVSGMSDLKWELHVIRDPTPNAFVLPGGKVFVFEGIL PMCKGEDGLAAVLAHETAHQVARHSAEKIAFTRAVSCIVFLAAASLDLSGQLSHFLLNFG LLLPFSRKMETEADYIGLMLMSQACFDPNAAKTLWERMDAAEGQMGKALAFASTHPSSKK RIRKIEEWLPEAQVKRETSDCYHETWPMLQSFKEVHW
Uniprot No.

Target Background

Function
A mitochondrial inner membrane protease integral to the quality control system. OMA1 cleaves and degrades mistranslated or misfolded membrane proteins, promoting their turnover.
Database Links
Protein Families
Peptidase M48 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is OMA1 and what is its role in mitochondrial function?

OMA1 is a zinc ion metalloproteinase located in the inner membrane of mitochondria. It functions as a redox-dependent protein with multiple transmembrane domains and zinc finger binding motifs. In mammals, OMA1 acts at the intersection of mitochondrial quality control and energy metabolism, where its activation correlates with outer membrane permeabilization and cytochrome c release during apoptosis .

While S. pombe-specific OMA1 function isn't fully characterized in current literature, it likely shares conserved functions with its homologs. Based on studies in other organisms, S. pombe OMA1 would be expected to play important roles in responding to mitochondrial stress and regulating mitochondrial dynamics through proteolytic processing of substrate proteins.

How does OMA1 structure relate to its function?

Human OMA1 comprises 524 amino acids with a molecular weight of approximately 60.1 kDa, containing a signal peptide (amino acids 1-13) . The mature protein features a HEXXH Zn²⁺-binding motif, classifying it as a metalloendopeptidase of the M48C-family .

Two competing structural models exist: OMA1 as a membrane-anchored protease or as an integral membrane protease. AlphaFold predictions favor the latter model, though a definitive 3D structure remains to be determined . S. pombe OMA1 likely shares these general structural features, with species-specific variations in regulatory domains.

How is OMA1 regulated in mitochondria?

OMA1 regulation is complex and context-dependent. Under normal conditions, OMA1 exists primarily in its mature 40-kD L-OMA1 isoform. Upon mitochondrial depolarization (such as that induced by the uncoupling drug CCCP), L-OMA1 undergoes autocatalytic cleavage at the C-terminal end to generate a 35-kD S-OMA1 isoform that is catalytically active but unstable .

Redox changes play a critical role in OMA1 activation. Studies in yeast identified cysteines 272 and 332 (corresponding to cysteines 403 and 461 in mouse) as important for this redox-dependent activation process . The positively charged amino-terminal domain appears crucial for activation, as mutations in this region impair activation without affecting proteolytic function .

What expression systems are optimal for producing recombinant S. pombe OMA1?

E. coli expression systems have proven effective for recombinant S. pombe mitochondrial proteins . When expressing OMA1, consider the following methodological approaches:

  • Fusion with protein disulfide-isomerase DsbC can optimize bacterial production, as demonstrated with mammalian OMA1

  • Express only the catalytic domain for higher yield, as was successful with recombinant OMA1 containing only the outer membrane domain with the catalytic site

  • Include appropriate affinity tags for purification

  • Express at lower temperatures (16-18°C) to improve folding of membrane proteins

  • Use specialized E. coli strains designed for membrane protein expression

Post-expression, careful storage conditions are essential for maintaining activity. Based on protocols for similar mitochondrial proteins, recombinant S. pombe OMA1 should be stored at -20°C/-80°C with 5-50% glycerol as a cryoprotectant .

How can the proteolytic activity of recombinant S. pombe OMA1 be measured in vitro?

OMA1 activity can be assessed through several methodological approaches:

  • Artificial substrate assays: Use synthetic peptides containing OMA1-specific cleavage sites, such as those based on OPA1 sequences

  • Native substrate processing: Monitor the cleavage of purified native substrates such as OPA1

  • OPA1 processing visualization: Measure the proportion of long form (L-OPA1) to short form (S-OPA1) using western blotting as an indicator of OMA1 activation

For quantitative analysis, establish a standard curve using varying concentrations of substrate and enzyme under controlled conditions. The effect of modulators (redox agents, membrane potential disruptors like CCCP) on activity rates provides valuable insights into regulatory mechanisms.

Table 1 summarizes experimental conditions for assessing OMA1 activity based on available research:

ConditionSubstrateDetection MethodExpected OutcomeNotes
BasalOPA1 peptide or full proteinWestern blot or HPLCLimited processingMaintain native redox environment
+CCCP (10μM)OPA1Western blotFull conversion to S-OPA1Activates OMA1 via membrane depolarization
+Cysteine modifiersOPA1Western blotAltered processing rateTests redox-dependent activation
C403A mutationOPA1Western blotImpaired response to CCCPDisrupts redox-sensing mechanism

What approaches are effective for studying OMA1 function in vivo in S. pombe?

For studying OMA1 function in living S. pombe cells, multiple complementary approaches can be employed:

  • Gene deletion studies: Create oma1Δ strains and characterize phenotypes under various growth conditions, particularly focusing on respiratory media and late stationary phase, where mitochondrial function becomes critical

  • Site-directed mutagenesis: Introduce mutations in key residues (e.g., the HEXXH motif or redox-sensing cysteines) to study their impact on OMA1 function

  • Protein interaction studies: Identify OMA1-interacting proteins through co-immunoprecipitation or proximity labeling approaches

  • Stress response assays: Subject cells to mitochondrial stressors (oxidative agents, CCCP, nutrient limitation) and monitor OMA1 activation

When designing these experiments, it's valuable to include related mitochondrial protein mutants as comparators. For instance, the phenotypic consequences of oma1 deletion could be compared with those of ppr10 deletion, which exhibits growth defects in respiratory media and impaired mitochondrial protein synthesis .

How does the redox state affect S. pombe OMA1 activation and function?

Research suggests OMA1 activation involves redox changes in specific cysteine residues. In yeast, cysteines 272 and 332 (corresponding to cysteines 403 and 461 in mouse) are implicated in redox-dependent activation . When investigating S. pombe OMA1 redox regulation, consider these methodological approaches:

  • Identify conserved cysteine residues through sequence alignment

  • Create cysteine-to-alanine mutants (e.g., C403A equivalent) and assess their activation response

  • Expose cells or purified protein to oxidizing/reducing conditions and monitor OMA1 activation

  • Use cysteine-modifying reagents to probe the accessibility and functional importance of specific residues

  • Employ redox proteomics to detect post-translational modifications of OMA1 under different conditions

Experimental evidence indicates that mutation of the cysteine equivalent to mouse Cys461 in yeast caused OMA1 instability, while mutation of the equivalent to Cys403 prevented cleavage of OMA1's target protein OPA1 under stress conditions . This suggests distinct roles for different cysteine residues in maintaining stability versus catalytic activity.

What is the relationship between OMA1 and mitochondrial quality control in S. pombe?

In mammals, OMA1 is central to mitochondrial quality control through its regulation of OPA1. When activated by mitochondrial depolarization or oxidative stress, OMA1 cleaves OPA1 at the S1 site, triggering mitochondrial fission and potentially leading to clearance of damaged mitochondria through mitophagy .

To investigate this relationship in S. pombe, researchers should:

  • Determine whether S. pombe OMA1 cleaves the S. pombe homolog of OPA1

  • Examine mitochondrial morphology in wild-type versus oma1Δ strains under normal and stress conditions

  • Monitor markers of mitophagy and compare between strains

  • Investigate genetic interactions between oma1 and genes involved in mitochondrial dynamics (fission/fusion) and mitophagy

The tools for this investigation would include fluorescence microscopy of mitochondrially-targeted fluorescent proteins, transmission electron microscopy for ultrastructural analysis, and genetic approaches including epistasis analysis with other quality control genes.

How does OMA1 interact with the Ppr protein network in S. pombe mitochondria?

S. pombe contains multiple PPR (pentatricopeptide repeat) proteins that modulate mitochondrial RNA expression, including Ppr1-9 . These proteins contain varying numbers of PPR motifs (2-18) and perform distinct functions in mitochondrial RNA metabolism. For example, Ppr10 associates with protein Mpa1 in the mitochondrial matrix and is required for accumulation of specific mitochondrial mRNAs and mitochondrial protein synthesis .

To investigate potential interactions between OMA1 and the PPR protein network:

  • Perform co-immunoprecipitation studies to identify physical interactions

  • Create double mutants (oma1Δ combined with various pprΔ strains) to assess genetic interactions

  • Compare mitochondrial RNA and protein expression profiles between single and double mutants

  • Investigate whether OMA1 proteolytically processes any PPR proteins, particularly under stress conditions

Understanding these interactions would provide insight into how proteolytic quality control systems integrate with RNA processing machinery in mitochondria.

How does S. pombe OMA1 compare to its homologs in other organisms?

OMA1 is evolutionarily conserved across many species, though with notable variations. While homologs have been identified in model organisms such as mice and yeast, they are notably absent in C. elegans and Drosophila .

Key comparative aspects include:

  • Structural variations: Mammalian OMA1 has an extended carboxyl terminal and a positively charged amino-terminal domain important for activation

  • Substrate specificity: Mammalian OMA1 cleaves OPA1 and DELE1 , but substrate specificity may vary across species

  • Activation mechanisms: While stress-induced activation appears conserved, the specific triggers and regulatory mechanisms may differ

  • Functional redundancy: In yeast, OMA1 shows overlapping activity with m-AAA protease , and similar redundancy might exist in S. pombe

For rigorous comparative analysis, researchers should perform sequence alignment, functional complementation assays, and domain swapping experiments between OMA1 proteins from different species.

What can we learn from research on mammalian OMA1 that applies to S. pombe studies?

Research on mammalian OMA1 provides valuable insights that can guide S. pombe studies:

  • Disease relevance: OMA1 dysfunction in mammals correlates with pathological outcomes. For instance, OMA1 inactivation affected tumor immunity in a sarcoma model

  • Integrated stress response: Mammalian OMA1 cleaves DELE1, connecting mitochondrial stress to the integrated stress response

  • Methodological approaches: Techniques for studying mammalian OMA1, such as using CCCP to induce activation and monitoring OPA1 processing as a readout, can be adapted for S. pombe

  • Regulatory mechanisms: The redox-dependent activation observed in mammalian OMA1 likely applies to S. pombe, guiding the design of experiments on redox regulation

When applying mammalian findings to S. pombe, researchers should verify the conservation of key regulatory sites and substrate recognition motifs before making functional inferences.

Table 2: Comparison of Mitochondrial Proteins in S. pombe and Their Functions

ProteinTypeLocationFunctionPhenotype of Deletion MutantReference
Ppr10PPR proteinMitochondrial matrixRequired for mitochondrial mRNA accumulation and protein synthesisGrowth defects in respiratory media, impaired viability during late-stationary phase
Mpa1Ppr10-associated proteinMitochondrial matrixAssociates with Ppr10, required for normal Ppr10 functionSimilar to ppr10 deletion
Mmm1Maintenance of mitochondrial morphology proteinMitochondrial membraneMaintenance of mitochondrial morphologyNot specified in search results
OMA1 (inferred)Zinc metalloendopeptidaseInner mitochondrial membraneLikely involved in stress response and regulation of mitochondrial dynamicsPredicted to affect mitochondrial morphology and stress response

What are the main challenges in purifying active recombinant S. pombe OMA1?

Purifying active membrane proteins like OMA1 presents several challenges:

  • Protein solubility: As a membrane protein, OMA1 requires appropriate detergents or amphipols for solubilization

  • Maintaining native conformation: The membrane environment is crucial for proper folding and activity

  • Redox sensitivity: The redox-dependent activation mechanism means purification conditions can affect activity state

  • Autoproteolysis: OMA1 undergoes autocatalytic processing, potentially reducing yield of full-length protein

Methodological approaches to address these challenges include:

  • Using mild detergents (DDM, LMNG) for extraction

  • Including reducing agents during purification to maintain redox state

  • Expressing truncated versions containing only the catalytic domain

  • Purifying at low temperatures (4°C) to minimize autoproteolysis

  • Adding protease inhibitors specific for metalloproteases

How can researchers address variable or inconsistent OMA1 activity in experimental systems?

Variability in OMA1 activity can stem from multiple factors:

  • Activation state: OMA1 exists in different activation states depending on cellular conditions

  • Redox environment: Changes in redox state affect activity

  • Substrate accessibility: Membrane organization influences substrate interaction

  • Post-translational modifications: These may vary between preparations

To ensure consistent results:

  • Standardize cell growth and stress induction protocols

  • Define precise biochemical conditions for in vitro assays

  • Include positive controls for activation (CCCP-treated samples)

  • Verify protein quality and quantity in each experiment

  • Perform multiple biological and technical replicates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.