Recombinant Schizosaccharomyces pombe Mitochondrial oxaloacetate transport protein (oac1)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

Oac1 facilitates the transport of mitochondrial substrates, including:

  • Oxaloacetate: A key intermediate in the citric acid cycle .

  • α-Isopropylmalate (α-IPM): A leucine biosynthesis intermediate .

  • Sulfate and malonate: Secondary substrates with lower affinity .

Key kinetic parameters:

SubstrateK<sub>m</sub>Inhibitors
α-IPM75 ± 4 μMα-Ketoisocaproate (competitive)
β-IPM0.31 ± 0.04 mMOxaloacetate, sulfate

Oac1 does not transport leucine, valine, or α-ketoisovalerate, distinguishing it from other mitochondrial carriers .

Expression and Purification

  • Host System: E. coli .

  • Tag: His-tagged for affinity chromatography .

  • Yield: Typically 0.1–1.0 mg/mL post-reconstitution .

Research Applications

  • Metabolic Studies: Investigating mitochondrial transport kinetics in leucine biosynthesis .

  • Structural Biology: Homology modeling based on bovine ADP/ATP carrier structures .

  • Disease Models: Studying metabolic disorders linked to mitochondrial dysfunction .

Comparative Analysis

Oac1 homologs exist across species, with functional differences:

SpeciesProtein LengthKey SubstratesExpression System
S. pombe (this protein)320 aaOxaloacetate, α-IPM, sulfate E. coli
S. cerevisiae (OAC1)324 aaOxaloacetate, malonate E. coli/yeast

Recent Research Findings

  • Substrate Specificity: Oac1 binds AT-rich DNA regions in fission yeast origins of replication, though this activity is distinct from its transport function .

  • Proteomic Profiling: S. pombe Oac1 was identified in large-scale proteomic studies, confirming its mitochondrial localization .

  • Inhibition Mechanisms: α-Ketoisocaproate competitively inhibits α-IPM transport, suggesting regulatory cross-talk between leucine biosynthesis and mitochondrial metabolism .

Future Directions

Current studies focus on:

  • Cryo-EM structural analysis to resolve substrate-binding pockets.

  • Genetic knockout models to elucidate Oac1’s role in fungal metabolism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
oac1; SPAC139.02c; Mitochondrial oxaloacetate transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
oac1
Target Protein Sequence
MSEKQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKL DPSKRIYKSVGQAFSLIARHEGIRGLQRGLGTAYVYQICLNGCRLGFYEPIRRTLNTWFL DDPKGNKLAINVASGAGSGLCGALFGSPFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSR IIKENGVKGLFVGADAAILRTVSGSSVQLPIYNWAKRMIEHYNLLEEGMIKHLTASAVSG FGVCCTMQIFDTVMTRMYNQKNKELYKNPIDCILKTIRSEGFFALYKGFGAHLARIAPHT IFCLTFVEQTNKLFLKFQKD
Uniprot No.

Target Background

Function
This protein facilitates the transport of oxaloacetate and sulfate.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of the mitochondrial oxaloacetate transport protein (oac1) in S. pombe?

The primary physiological role of oac1 in Schizosaccharomyces pombe is anaplerotic, meaning it replenishes mitochondrial TCA cycle intermediates that are consumed during anabolic reactions. Specifically, oac1 mediates the import of oxaloacetate into mitochondria by exchanging cytosolic oxaloacetate with mitochondrial sulfate. This transport mechanism is critical for maintaining the balance of TCA cycle intermediates and ensuring proper cellular metabolism. The protein functions as a mitochondrial anion transporter that facilitates the movement of specific metabolites across the mitochondrial membrane, thereby connecting cytosolic and mitochondrial metabolic pathways. Unlike its counterpart Dic1, which exchanges cytosolic malate or succinic acid with mitochondrial phosphate, oac1 specifically handles oxaloacetate-sulfate exchange .

How does oac1 differ from other mitochondrial transporters in yeast species?

In Saccharomyces cerevisiae, two mitochondrial transporters enable the net uptake of rTCA intermediates and succinic acid into the mitochondria: Oac1 and Dic1. While Oac1 mediates oxaloacetate import by exchanging cytosolic oxaloacetate with mitochondrial sulfate, Dic1 mediates malate and succinic acid import by exchanging these molecules with mitochondrial phosphate. These transporters have distinct substrate specificities and exchange partners despite their shared role in anaplerotic functions. The S. pombe oac1 maintains similar functionality to its S. cerevisiae counterpart but operates within the unique metabolic context of fission yeast. Unlike some other mitochondrial transporters that may have redundant functions, deletion studies have shown that Oac1 and Dic1 cannot fully compensate for each other's loss, indicating their distinct and non-redundant roles in mitochondrial metabolism .

What are the gene and protein characteristics of S. pombe oac1?

The S. pombe mitochondrial oxaloacetate transport protein is encoded by the oac1 gene, also designated as SPAC139.02c in the S. pombe genome database. The protein is classified as a mitochondrial anion transporter. Alternative names include "mitochondrial anion transporter (predicted)" and simply "mitochondrial oxaloacetate transport protein." The gene has been characterized through genomic and functional studies in S. pombe, which is an excellent model organism for exploring cellular events due to the rich tools available in genetics, molecular biology, cellular biology, and biochemistry. The protein contains transmembrane domains characteristic of mitochondrial carrier proteins and functions within the mitochondrial membrane to facilitate selective transport of specific anions .

What expression systems are most effective for producing recombinant S. pombe oac1 protein?

Recombinant S. pombe mitochondrial oxaloacetate transport protein can be effectively produced in several expression systems, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay lack proper post-translational modifications
Yeast (S. cerevisiae)Native-like post-translational modifications, proper foldingLower yield than bacterial systems
BaculovirusEukaryotic modifications, handles complex proteinsMore complex setup, longer production time
Mammalian CellMost authentic post-translational modificationsHighest cost, technical complexity

The choice of expression system depends on the specific research requirements. For structural studies requiring large quantities, E. coli may be preferred despite potential limitations in post-translational modifications. For functional studies where protein activity is paramount, yeast or baculovirus systems offer a better balance of yield and proper protein folding. Commercial preparations of recombinant S. pombe oac1 are typically produced in one of these systems and supplied as a liquid containing glycerol with purity typically exceeding 90% .

What purification strategies are most effective for isolating functional oac1 protein?

The purification of functional mitochondrial membrane proteins like oac1 requires specialized techniques to maintain protein stability and activity. A comprehensive purification strategy might include:

  • Initial Extraction: Membrane proteins require detergent-based extraction from cellular membranes. Common detergents include n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS.

  • Affinity Chromatography: Utilizing histidine tags (His-tag) or other affinity tags fused to recombinant oac1 allows for efficient initial purification.

  • Ion Exchange Chromatography: This technique separates proteins based on charge differences and can be effective for further purification of oac1.

  • Size Exclusion Chromatography: As a final polishing step, this method separates proteins based on size and can remove aggregates.

Throughout the purification process, it's critical to maintain an environment that mimics the native mitochondrial membrane environment, possibly by including phospholipids or lipid nanodiscs in the buffer systems. The purified protein should be stabilized with glycerol and stored at -20°C for short-term use or -80°C for long-term storage to maintain functionality. Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of transport activity .

How can researchers design experiments to study the kinetics of oxaloacetate transport by oac1?

Studying the kinetics of oxaloacetate transport by oac1 requires carefully designed experiments that can monitor substrate movement across membranes. A comprehensive experimental approach might involve:

  • Liposome Reconstitution Systems: Purified oac1 can be reconstituted into liposomes with defined lipid composition to create a controlled environment for transport studies.

  • Radioisotope Flux Assays: Using radiolabeled oxaloacetate (e.g., 14C-oxaloacetate) to track its movement into liposomes containing reconstituted oac1.

  • Fluorescence-Based Assays: pH-sensitive or membrane potential-sensitive fluorescent dyes can detect changes associated with transport activity.

  • Electrophysiological Methods: Patch-clamp techniques applied to proteoliposomes or native mitochondrial membranes can measure electrical currents associated with transport.

For comprehensive kinetic analysis, experiments should measure initial transport rates across a range of substrate concentrations to determine parameters such as Km (substrate concentration at half-maximal transport rate) and Vmax (maximum transport rate). Inhibitor studies using competitive and non-competitive inhibitors can provide additional insights into transport mechanisms. Temperature dependence and pH dependence studies can further characterize the transport properties and optimal conditions for oac1 activity. When designing these experiments, it's essential to include proper controls such as liposomes without protein or with denatured protein .

How does deletion of the oac1 gene affect mitochondrial function and cellular metabolism in S. pombe?

Deletion of the oac1 gene (oac1Δ) in S. pombe has significant effects on mitochondrial function and cellular metabolism. When transferred from glucose-based medium to glycerol-based medium, the oac1Δ strain exhibits a prolonged lag phase compared to wild-type cells. This indicates adaptation difficulties when switching from fermentative to respiratory metabolism. Despite this initial growth delay, the oac1Δ strain eventually reaches similar growth rates as reference strains, suggesting the activation of compensatory mechanisms over time.

At the molecular level, oac1 deletion likely results in altered cytosolic and mitochondrial oxaloacetate levels, which may have downstream effects on gluconeogenesis, amino acid biosynthesis, and other metabolic pathways that utilize oxaloacetate as a precursor. The cell appears to adapt to these changes through metabolic reprogramming, allowing for continued growth despite the initial adaptation period .

How can researchers use oac1 as a target for metabolic engineering in S. pombe?

Mitochondrial transporters like oac1 represent attractive targets for metabolic engineering due to their central role in controlling the flux of key metabolites between cellular compartments. For S. pombe, several approaches can be employed:

  • Controlled Expression Modulation: Rather than complete deletion, fine-tuning oac1 expression using inducible promoters or CRISPR-based transcriptional regulation can allow for precise control of oxaloacetate flux between cytosol and mitochondria.

  • Protein Engineering: Modifying the transport properties of oac1 through targeted mutations can alter substrate specificity or transport rates, potentially redirecting metabolic flux towards desired pathways.

  • Coordinated Transporter Engineering: Simultaneous modification of multiple transporters (e.g., oac1 and dic1) can create synergistic effects for redirecting metabolic flux.

  • Integration with Central Metabolism Modifications: Combining oac1 engineering with modifications to TCA cycle enzymes or other metabolic pathways can enhance desired phenotypes.

The goal of such engineering might be to increase production of specific metabolites, enhance stress resistance, or optimize growth under specific conditions. For example, controlled limitation of oxaloacetate transport into mitochondria might redirect this metabolite towards cytosolic pathways for the production of amino acids or other valuable compounds. Successful metabolic engineering strategies should consider the entire metabolic network and potential regulatory responses to modifications of transport activities .

What techniques are available for studying the structure-function relationship of the oac1 protein?

Understanding the structure-function relationship of oac1 requires a combination of structural biology techniques and functional assays:

TechniqueInformation ProvidedLimitations
X-ray CrystallographyHigh-resolution 3D structureChallenging for membrane proteins
Cryo-Electron Microscopy3D structure in near-native stateSample preparation challenges
NMR SpectroscopyDynamic structural informationSize limitations
Molecular Dynamics SimulationsConformational changes during transportComputational limitations
Site-Directed MutagenesisFunction of specific residuesLabor-intensive
Chimeric Protein AnalysisDomain function identificationComplex interpretation
Cross-linking StudiesProtein-protein interactionsPotential artifacts

A comprehensive approach might involve generating a structural model using homology modeling based on related mitochondrial carriers with known structures. This model can then guide site-directed mutagenesis experiments targeting residues predicted to be involved in substrate binding or conformational changes. Mutant proteins can be characterized using transport assays to correlate structural features with functional properties. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide information about protein dynamics and conformational changes associated with transport activity. Combining these methods can yield valuable insights into how oac1 structure determines its specific transport properties .

How should researchers interpret contradictory results from oac1 deletion studies?

When facing contradictory results from oac1 deletion studies, researchers should employ a systematic approach to reconcile the discrepancies:

  • Examine Strain Background Differences: Genetic background variations between different S. pombe strains can significantly influence the phenotypic effects of oac1 deletion. Document all genetic differences between strains used in contradictory studies.

  • Evaluate Growth Conditions: The effects of oac1 deletion may vary dramatically depending on carbon source, nitrogen availability, oxygen levels, and other environmental factors. For instance, the phenotype of oac1Δ strains differs when grown on glucose versus glycerol-based media.

  • Consider Compensatory Mechanisms: Long-term adaptation through compensatory genetic or metabolic changes can mask the immediate effects of oac1 deletion. Compare acute versus chronic responses to gene deletion.

  • Assess Methodological Differences: Variations in how transport activity, growth, or metabolite levels are measured can lead to apparently contradictory results. Standardize measurement techniques or carefully account for methodological differences.

  • Perform Complementation Studies: Re-introducing the wild-type oac1 gene or expressing it under controlled conditions can confirm that observed phenotypes are directly attributable to oac1 function.

For example, one study observed that oac1Δ strains eventually reached similar growth rates as reference strains despite an initial lag phase, while another study might report persistent growth defects. These apparently contradictory results could be reconciled by considering the duration of the experiment, specific growth conditions, or the possibility of suppressor mutations arising during prolonged culture. Transparent reporting of all experimental conditions and strain characteristics is essential for proper interpretation and reproducibility .

What bioinformatic approaches can be used to analyze oac1 sequence conservation and predict functional domains?

Several bioinformatic approaches can be employed to analyze oac1 sequence conservation and predict functional domains:

  • Multiple Sequence Alignment (MSA): Comparing oac1 sequences across different species can identify conserved residues that are likely functionally important. Tools like Clustal Omega, MUSCLE, or T-Coffee can be used for this purpose.

  • Phylogenetic Analysis: Constructing phylogenetic trees of mitochondrial carrier proteins can provide insights into the evolutionary relationships and functional divergence of oac1. Methods like Maximum Likelihood or Bayesian inference are commonly used.

  • Conservation Scoring: Algorithms such as ConSurf can quantify the evolutionary conservation of each amino acid position and map this information onto structural models.

  • Transmembrane Domain Prediction: Tools like TMHMM, Phobius, or TOPCONS can predict the transmembrane segments that anchor oac1 in the mitochondrial membrane.

  • Substrate-Binding Site Prediction: Methods combining evolutionary conservation, structural information, and physicochemical properties can predict residues involved in oxaloacetate binding.

  • Protein-Protein Interaction Prediction: Tools like STRING can predict potential interaction partners that might regulate oac1 function.

  • Molecular Modeling: Homology modeling based on structures of related mitochondrial carriers can provide structural insights when experimental structures are unavailable.

These approaches can be integrated to create a comprehensive functional annotation of oac1, identifying key residues for substrate recognition, transport mechanism, and regulation. For instance, comparing S. pombe oac1 with S. cerevisiae Oac1 and other mitochondrial carriers can highlight species-specific adaptations while revealing the core conserved functional elements .

How can researchers quantitatively assess the impact of oac1 on cellular metabolic flux?

Quantitatively assessing the impact of oac1 on cellular metabolic flux requires advanced metabolic analysis techniques:

Data from these approaches can be integrated to create a comprehensive picture of how oac1 influences metabolic flux distribution. For example, deletion studies have shown that oac1Δ strains exhibit a prolonged lag phase when shifting from glucose to glycerol medium, suggesting temporary metabolic inefficiency that is eventually compensated through flux rearrangements. Precise quantification of these flux changes can guide metabolic engineering efforts targeting oac1 and related transporters .

What are the major technical challenges in studying mitochondrial membrane transporters like oac1?

Studying mitochondrial membrane transporters like oac1 presents several significant technical challenges:

  • Protein Expression and Purification: Membrane proteins are notoriously difficult to express and purify in their native conformation. They often form aggregates when overexpressed and require careful detergent selection for extraction from membranes without denaturation.

  • Functional Reconstitution: Establishing reliable systems for reconstituting purified transporters into liposomes or other membrane mimetics while maintaining transport activity is technically demanding.

  • Subcellular Fractionation: Isolating pure mitochondria without contamination from other organelles is challenging but necessary for studying native oac1 in its physiological context.

  • Transport Assay Sensitivity: Developing assays sensitive enough to detect and quantify the relatively low transport rates of mitochondrial carriers requires specialized equipment and methods.

  • Structural Determination: Obtaining high-resolution structures of mitochondrial transporters is challenging due to their flexibility, hydrophobicity, and relatively low natural abundance.

  • Compartment-Specific Metabolite Measurement: Accurately measuring metabolite concentrations specifically in the mitochondrial matrix versus the cytosol requires sophisticated techniques that don't disrupt the compartmentalization during sample preparation.

  • Genetic Redundancy: Potential functional overlap between different transporters can mask phenotypes in single deletion studies, necessitating complex multiple deletion approaches.

Addressing these challenges requires interdisciplinary approaches combining advanced biochemical techniques, genetics, metabolomics, and structural biology methods. Development of new technologies like nanoscale apolipoprotein-bound bilayers (nanodiscs) for membrane protein stabilization and advanced imaging techniques may help overcome some of these limitations .

How might research on S. pombe oac1 contribute to understanding human metabolic disorders?

Research on S. pombe oac1 can contribute significantly to understanding human metabolic disorders through several pathways:

  • Functional Conservation: Mitochondrial carrier proteins are evolutionarily conserved from yeast to humans. The human homologs of oac1 belong to the SLC25 family of transporters, which includes members implicated in various metabolic disorders. Insights from S. pombe oac1 can provide fundamental knowledge applicable to human transporters.

  • Metabolic Modeling Systems: S. pombe provides a simplified yet relevant system for modeling metabolic disorders associated with mitochondrial transport defects. The core metabolic pathways affected by oac1 function, including TCA cycle anaplerosis, are conserved in humans.

  • Drug Discovery Platform: Yeast systems with altered oac1 function can serve as platforms for screening compounds that might modulate mitochondrial transport activity, potentially leading to therapeutic interventions for human metabolic disorders.

  • Genetic Interaction Networks: Systematic genetic interaction studies in S. pombe can reveal how oac1 interacts with other genes, providing insights into potential modifier genes that might influence disease severity in human mitochondrial disorders.

  • Stress Response Mechanisms: Understanding how S. pombe cells adapt to oac1 deletion or dysfunction can illuminate cellular response mechanisms that might be targeted therapeutically in human disorders.

Specific human disorders that might benefit from S. pombe oac1 research include mitochondrial diseases affecting TCA cycle function, metabolic disorders involving altered carbon metabolism, and potentially aspects of diabetes, obesity, and neurodegenerative diseases where mitochondrial metabolism plays a key role .

What emerging technologies might advance our understanding of oac1 structure and function?

Several emerging technologies hold promise for advancing our understanding of oac1 structure and function:

TechnologyPotential Application to oac1 ResearchCurrent Status
Cryo-Electron Microscopy (Cryo-EM)High-resolution structural determination of oac1 in different conformational statesRapidly advancing for membrane proteins
Single-Molecule FRETObserving conformational changes during transport cycleEmerging application for transporters
Nanobody-Assisted CrystallographyStabilizing specific conformations for structural studiesSuccessfully applied to other transporters
In-Cell NMRStudying oac1 dynamics in its native environmentStill developing for membrane proteins
Mass PhotometryAnalyzing oac1 oligomeric state and interactionsNew technique with growing applications
CRISPR-Based Transcriptional ModulationPrecise control of oac1 expression levelsWell-established in model organisms
Organelle-Specific MetabolomicsMeasuring substrate levels in distinct compartmentsAdvancing with new isolation techniques
Artificial Intelligence Structure PredictionGenerating accurate structural models from sequenceRecently demonstrated high accuracy

The integration of these technologies could lead to a comprehensive understanding of how oac1 structure dictates its function in oxaloacetate transport. For example, combining AI-predicted structures with targeted mutagenesis and advanced functional assays could rapidly advance our understanding of the transport mechanism. Single-molecule techniques might reveal previously undetectable intermediate states in the transport cycle. Organelle-specific imaging and metabolomic techniques could provide unprecedented insights into how oac1 activity influences metabolite distribution within living cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.