Recombinant Schizosaccharomyces pombe Mitochondrial respiratory chain complexes assembly protein rca1 (SPBC543.09)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Mitochondrial Respiratory Chain Complexes Assembly Protein rca1 (SPBC543.09)

The recombinant Schizosaccharomyces pombe mitochondrial respiratory chain complexes assembly protein rca1 (SPBC543.09) is a crucial component involved in the assembly of mitochondrial respiratory chain complexes. These complexes are essential for the generation of ATP in eukaryotic cells, including those of Schizosaccharomyces pombe, a model organism often used in molecular biology research.

Function and Importance

The rca1 protein plays a significant role in ensuring the proper assembly and function of mitochondrial respiratory chain complexes. Mitochondrial respiratory chain complexes are vital for cellular respiration, where they facilitate the transfer of electrons and generate ATP through oxidative phosphorylation. In S. pombe, as in other eukaryotes, these complexes are crucial for energy metabolism and maintaining cellular homeostasis.

Protein Characteristics

The rca1 protein is encoded by the SPBC543.09 ORF in S. pombe. It has a specific amino acid sequence that defines its structure and function. The protein sequence includes various motifs and domains that are crucial for its role in assembling mitochondrial respiratory chain complexes.

Protein FeatureDescription
ORF NameSPBC543.09
Protein Namerca1
FunctionAssembly of mitochondrial respiratory chain complexes
Sequence Length773 amino acids

Experimental Tools and Techniques

For studying rca1 (SPBC543.09), researchers often use recombinant protein expression systems. These systems allow for the production of large quantities of the protein, which can then be purified and analyzed using techniques like ELISA (Enzyme-Linked Immunosorbent Assay) . S. pombe itself is a popular host for eukaryotic protein expression due to its ability to perform post-translational modifications, which are critical for protein function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
yta12; SPBC543.09; Mitochondrial respiratory chain complexes assembly protein rca1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-773
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
yta12
Target Protein Sequence
MRNPFLTFRAPTRKTGDYLVSKFVKKDNFSSLRLARAYTFSTRSTAVSQFSLLSLSQRSF QSLKINKGIPEKHKIPLISSKQFSVTSKRSQNGSSGSNSDANGRKNGQKNDDSKKKGLNG NDPKKVFEIALNGNTILGGILVAYILYNVLSPNANMQEITWQDFRQQFLDKGLVERLVVV NRNMVRVILRGGVASGSGQYYFSIGSIDSFDRKLEDAQRQLGIPPSEFVPVAYHDEVSVL ATLLSFAPTLLIIGSVIYLSRRASGAAGGGQGGIFGIGKSRAKMFNHETDIKIKFADVAG VDEAKEEIMEFVKFLKNPKFYERLGAKIPRGAILSGPPGTGKTLLAKATAGEANVPFLSV SGSEFLEMFVGVGPSRVRDLFATARKNAPCIIFIDEIDAIGKARGRGGQFGSNDERESTL NQLLVEMDGFTSSEHIVVFAGTNRPDVLDPALLRPGRFDRQITIDRPDIGGREQIFKVHL KHIKAADNIDLIAKRLAVLTSGFTGADIMNVCNEGALIAARSNSNEVQMVHFEQAIERVT AGLEKKSRVLSPEEKNTVAHHEAGHAVAGWFMEYVDPLLKVSIIPRAQALGYASYLPKDQ YLMSRGQILDQMGMALAGRVSEEIFFGPEKITSGASDDFQKVTRMAQAYVTQYGMSPTVG TIAYPIDTRETVQKPFSEATAQMIDEEIRKLVKHAYERTKKLLLEHKQGLENIAQRLLQK EVITYNEVETILGPRPYAYKHLNISELMRQSEYKNDHDPRNPPIPPSPQQPSA
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Mitochondrial respiratory chain complexes assembly protein rca1 (SPBC543.09) is a component of the m-AAA protease complex. This ATP-dependent metalloprotease degrades unassembled mitochondrial inner membrane proteins. The complex is essential for the assembly of mitochondrial respiratory chain and ATPase complexes. It functions in both post-translational assembly and the turnover of misfolded or mistranslated polypeptides.

Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.