Recombinant Schizosaccharomyces pombe Multidrug resistance protein fnx1 (fnx1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Fnx1

Fnx1 belongs to the Major Facilitator Superfamily (MFS) of transporters, which typically facilitate the movement of small molecules across membranes via proton gradients . Key features include:

  • Gene: fnx1+ (SPBC3E7.06c homolog in S. pombe) .

  • Protein Structure: Predicted 12 transmembrane domains with sequence homology to multidrug resistance transporters .

  • Recombinant Expression: Overexpressed using the nmt1 promoter in plasmid vectors (e.g., pREP1) . Full-length ORF expression induces phenotypic changes mimicking nitrogen starvation .

Genetic Constructs and Modifications

ConstructPurpose/OutcomeSource
pREP1-fnx1+Induces G0 arrest under derepression
Δfnx1 deletionImpaired amino acid uptake and starvation response
GFP-tagged Fnx1Localizes to vacuolar membrane

Entry into Quiescence (G0)

  • Overexpression of fnx1+ triggers morphological and transcriptional changes resembling nitrogen starvation, including cell rounding and growth arrest .

  • Proposed mechanism: Export of a signaling molecule to coordinate cell-to-cell communication during stress .

Multidrug Resistance

  • Structural similarity to MFS transporters suggests a role in efflux of xenobiotics or metabolites .

  • Genetic interaction with tsc1+/tsc2+ (tuberous sclerosis complex homologs) links fnx1 to nutrient sensing and stress adaptation .

Vacuolar Amino Acid Transport

  • Fnx1 and its homolog Fnx2 are critical for vacuolar uptake of lysine, isoleucine, and asparagine .

  • Key finding: Δfnx1 mutants show 40–60% reduction in amino acid uptake efficiency compared to wild-type .

Phenotypic Effects of Overexpression

  • Growth Arrest: Cells expressing recombinant fnx1 cease proliferation within 12–18 hours under derepressed conditions .

  • Morphology: Shortened, rounded cells with bright phase-contrast appearance, mimicking nitrogen-starved cells .

Genetic Interactions

  • Suppression by cpp1-1: A farnesyltransferase mutation (Δtsc2 cpp1-1) restores leucine uptake and starvation gene induction in Δfnx1 backgrounds .

  • Role in Iron Regulation: Indirect interaction with Grx4 and Fep1, regulators of iron homeostasis, suggesting cross-talk between nutrient sensing pathways .

Proteomic Impact

  • Comparative proteomics in high-secretion S. pombe strains revealed fnx1 is not directly upregulated during protein secretion stress, but pathways linked to amino acid biosynthesis and membrane fluidity are critical .

Applications and Implications

  • Drug Resistance Studies: Fnx1 serves as a model for understanding MFS transporter mechanisms in eukaryotes .

  • Biotechnology: Insights into vacuolar transport could optimize protein secretion systems in yeast .

  • Therapeutic Targets: Homologs in pathogenic fungi (e.g., Aspergillus flavus) may inform antifungal drug development .

Unresolved Questions

  • Substrate Specificity: The exact molecule(s) transported by Fnx1 remain unidentified.

  • Signaling Role: Nature of the putative extracellular signal coordinating G0 entry is unknown .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
fnx1; SPBC12C2.13c; SPBC21D10.04c; Multidrug resistance protein fnx1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-531
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
fnx1
Target Protein Sequence
MVDQVNLATEQTSLLYPEVSRKKEELSVNKWTILPALWVGGFLSALDMTIVASLYPVIGS EFKLMNNASYIVTAYLITNTAFQPLYGRLSDIFGRRPTVVFANAAFTLGTFWCGISRSLP ELCMARALAGIGGGGLGTMSSIISSDIVSLRERGTWQGITNIVWGIGGSLGGPLGGLIAQ RWGWRTAFHFQVPMGILSTILVAWRVRVKPTVRNSNASLLSRIDYLGSFLLVTGITALVV TFNMGGDAFPWVSPVIITLLVSSVLILFAFYWVEKNIAVEPIAPVEILSQPTPLNVCLGN FFNAFCSFVIVYELPLFFETTLLMPSSEAGVRIFPYVISTSVGSLCSGLYMKKTGRYRNL VIAGFFFMLMGIVSFAVLTSFGHRTPLILISLCLAMTGCSYGMNLTSTLIAIISSLAPEE QAVATGLSYLFRATGSVIGISLSQTTTLSILMKQLASNLKDDPDKDDLIRRLRESISIIP NLPKDIQKLVIKSYATAFTWTFALVAIIAFAGFWCSLRIKQFYLHTSVDRS
Uniprot No.

Target Background

Function
Efflux transporter. Confers resistance to a variety of toxic compounds.
Gene References Into Functions
  1. These results suggest that fnx1(+) and fnx2(+) are involved in vacuolar amino acid uptake in S. pombe. PMID: 18503766
Database Links
Protein Families
Major facilitator superfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the functional role of fnx1 in Schizosaccharomyces pombe?

The fnx1+ gene in S. pombe encodes a protein that plays a critical role in the cellular response to nitrogen starvation. Research demonstrates that fnx1+ is essential for the entry into the quiescent G0 state that is normally induced when cells are deprived of nitrogen. The protein functions as part of a signaling pathway that enables cells to respond appropriately to nutrient limitation, which is vital for their long-term survival in natural environments where nutrients are often scarce .

Unlike many stress response elements that are activated by multiple stimuli, fnx1+ shows specific activation in response to nitrogen starvation but not other forms of nutrient limitation. This specificity suggests a specialized role in nitrogen sensing rather than a general stress response mechanism .

Based on sequence homology, the fnx1 protein belongs to the multidrug resistance group of the major facilitator superfamily of proteins, which typically function as proton-driven plasma membrane transporters. This classification suggests that fnx1 may facilitate the transport of specific molecules across the cell membrane, potentially as part of a signaling cascade or cell-to-cell communication system .

How is fnx1 expression regulated in response to environmental conditions?

Northern blot analysis reveals that fnx1+ transcription is rapidly and significantly upregulated in response to nitrogen starvation. Quantitative measurements demonstrate approximately a sevenfold increase in fnx1+ RNA levels shortly after cells are shifted to medium lacking nitrogen .

This transcriptional activation appears to be highly specific to nitrogen limitation, as similar upregulation is not observed when cells are starved of carbon or other nutrients. The rapid induction suggests that fnx1+ is an early responder in the nitrogen starvation pathway, potentially playing a role in initiating the cellular adaptation to these conditions .

The regulatory elements and transcription factors controlling fnx1+ expression have not been fully characterized, though they appear distinct from those involved in osmotic stress responses. While the transcription factor atf1 is known to implement transcriptional differentiation programs in response to various environmental stresses, evidence suggests that neither the wis1 signaling pathway nor the atf1 transcription factor are directly implicated in the transition to G0 in response to nitrogen starvation, highlighting a potentially unique regulatory mechanism for fnx1+ .

Overexpression Phenotypes:

When fnx1+ is overexpressed in S. pombe cells growing in nutrient-rich conditions, it induces phenotypic changes that mimic those observed in nitrogen-starved cells:

  • Growth arrest compared to cells with repressed fnx1+ expression

  • Short and rounded cell morphology characteristic of starved cells

  • Bright appearance under phase microscopy

  • High resistance to heat shock (48°C)

  • Enrichment of cells with 1C DNA content, typical of nitrogen-starved cells but not carbon-starved cells

These observations demonstrate that elevated fnx1+ expression alone is sufficient to trigger a starvation-like response even in the presence of adequate nutrition, suggesting it plays a regulatory rather than merely responsive role in the starvation pathway .

Deletion Phenotypes:

Analysis of Δfnx1 mutants reveals defects in the cellular response to nitrogen starvation. When wild-type and Δfnx1 cells were transferred to nitrogen-free medium and monitored for survival over 21 days, the deletion mutants showed significantly reduced long-term viability, indicating that fnx1+ is required for proper entry into the quiescent state that enables survival during prolonged nutrient limitation .

Additionally, experiments examining the response of cells at different densities showed that Δfnx1 cells have impaired ability to adapt to nitrogen starvation conditions compared to wild-type cells, further confirming the essential role of fnx1+ in this stress response pathway .

What are the most efficient techniques for genetic manipulation of the fnx1 locus?

Researchers working with the fnx1 locus in S. pombe should consider several approaches to optimize targeting efficiency, particularly as some genomic loci can be challenging to manipulate:

Modified Transformation Procedure:

A significant improvement in transformation efficiency (up to 5-fold increase) can be achieved when using antibiotic-based dominant selection markers through a modified transformation procedure. This enhancement is particularly valuable for loci that typically show low targeting rates (below 5%), which can otherwise limit the feasibility of genetic manipulations .

NHEJ Component Deletion:

Removal of the non-homologous end joining (NHEJ) machinery components, specifically the S. pombe homologues of Ku70 and Ku80 (Pku70 and Pku80), has been demonstrated to significantly increase targeting efficiency. This approach is particularly effective for loci that are difficult to target using standard methods .

Extended Homology Regions:

For challenging loci, extending the region of homology with the genome beyond what is typically used in PCR-based targeting can enhance the efficiency of targeting. This approach helps overcome issues related to illegitimate recombination that may otherwise dominate when targeting certain regions of the genome .

Targeting MethodKey FeaturesAdvantagesConsiderations
Modified transformation with antibiotic markersUses dominant selection5-fold efficiency increaseWorks best with antibiotic selection
Pku70/Pku80 deletion strainsRemoves NHEJ machinerySignificantly increases homologous recombinationRequires special background strains
Extended homology regionsLonger matching sequencesReduces illegitimate recombinationRequires additional cloning steps

Researchers should consider combining these approaches when working with the fnx1 locus, particularly if initial attempts at gene targeting yield low efficiency .

How can researchers analyze the role of fnx1 in nitrogen starvation response pathways?

To thoroughly investigate fnx1's role in nitrogen starvation response pathways, researchers should implement a multi-faceted experimental approach:

Transcriptional Analysis:

Northern blot analysis can be used to monitor fnx1+ RNA levels following shifts to media lacking various nutrients. As demonstrated in the literature, this approach effectively shows the specific and rapid upregulation of fnx1+ in response to nitrogen starvation. RNA-seq or qPCR methods can provide more quantitative measurements and enable genome-wide assessments of gene expression changes .

Phenotypic Characterization:

Comparing wild-type, fnx1-overexpressing, and Δfnx1 cells across various physiological parameters provides insights into fnx1's functional significance. Key phenotypes to assess include:

  • Cell morphology (light microscopy)

  • Growth kinetics in nitrogen-replete and nitrogen-depleted conditions

  • Heat shock resistance (e.g., at 48-50°C)

  • Cell cycle distribution (FACS analysis of DNA content)

  • Long-term viability during nitrogen starvation (survival assays)

Cell Density Experiments:

Assessing the response of cells at different densities to nitrogen starvation can reveal insights into potential cell-to-cell communication roles. Experiments comparing the behavior of wild-type and Δfnx1 cells at various concentrations (e.g., 2 × 10^7/ml with 10-fold serial dilutions) in nitrogen-depleted media can be particularly informative .

Genetic Interaction Studies:

Synthetic genetic arrays (SGAs) or targeted double-mutant analyses combining fnx1 mutations with mutations in known nitrogen-sensing, stress response, or cell cycle regulatory genes can identify functional relationships and place fnx1 within specific signaling networks.

What experimental approaches can identify substrates transported by fnx1?

As a putative membrane transporter from the MDR family, identifying the molecules transported by fnx1 is crucial to understanding its mechanism. Several complementary approaches can be employed:

Transport Assays:

Researchers can develop in vitro or in vivo transport assays using radioactively or fluorescently labeled candidate molecules. If fnx1 indeed facilitates "the release of a signaling substance into the environment as a means of cell-to-cell communication," as hypothesized in the literature, potential signaling molecules (small peptides, nucleotides, or metabolites) should be systematically tested .

Metabolomic Analysis:

Comparative metabolomic profiling of extracellular and intracellular contents from wild-type versus Δfnx1 strains under nitrogen starvation conditions may reveal differences in specific metabolite levels, pointing to potential substrates. Mass spectrometry and NMR-based approaches can be particularly valuable for this purpose.

Structural Modeling and Docking:

Homology modeling of fnx1 based on crystal structures of related MDR transporters, followed by in silico docking studies with candidate molecules, can predict potential substrates for subsequent experimental validation.

Substrate Trapping:

Engineering fnx1 variants with mutations in residues predicted to be involved in the transport cycle may create "substrate traps" that bind but cannot complete the transport of substrates, facilitating their identification through co-purification and mass spectrometry.

How does the fnx1-mediated response interact with other cellular stress pathways?

Understanding how the fnx1-mediated nitrogen starvation response interfaces with other stress response pathways requires careful experimental design:

Transcriptional Profiling Under Multiple Stresses:

Analyze fnx1 expression under various stress conditions (osmotic stress, heat shock, oxidative stress) in addition to nitrogen starvation. Available data suggest specificity to nitrogen starvation, but comprehensive profiling can reveal subtle interactions or co-regulation .

Pathway Component Analysis:

While the literature indicates that "neither the wis1 signaling pathway nor the atf1 transcription factor are implicated in the transition to G0 in response to nitrogen starvation," systematic analysis of other signaling components can identify the pathways through which fnx1 acts .

Double Mutant Phenotyping:

Create and analyze strains combining Δfnx1 with deletions in key components of other stress response pathways (e.g., MAPK cascades, TOR signaling) to identify synthetic interactions that would indicate functional relationships.

Phosphoproteomic Analysis:

Compare the phosphorylation states of signaling proteins in wild-type versus fnx1-overexpressing or Δfnx1 cells to identify changes in signaling pathway activation, potentially revealing connections between fnx1 and established stress response networks.

What are the most effective methods for producing recombinant fnx1 protein for biochemical studies?

Production of functional recombinant membrane proteins like fnx1 presents significant challenges that must be addressed with specialized approaches:

Expression Systems:

Several expression systems should be evaluated for optimal fnx1 production:

  • Yeast systems: S. cerevisiae or P. pastoris often provide the correct folding environment for fungal membrane proteins

  • Insect cell expression: Baculovirus-infected insect cells can yield higher amounts of functional membrane proteins

  • Bacterial systems with membrane-protein specific modifications: E. coli strains engineered for membrane protein expression with proper chaperones

Solubilization Strategies:

Membrane proteins require careful solubilization to maintain native structure and function:

  • Detergent screening (different types and concentrations)

  • Nanodiscs or other membrane mimetics

  • Styrene maleic acid lipid particles (SMALPs) that extract proteins with their native lipid environment

Purification Approach:

A multi-step purification strategy should be implemented:

  • Affinity chromatography using epitope tags (His, FLAG, etc.)

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Ion exchange chromatography for final polishing

Functional Validation:

Confirming that recombinant fnx1 retains native function is essential:

  • Liposome reconstitution followed by transport assays

  • Binding studies with potential substrates

  • ATPase or proton transport assays if applicable to fnx1's mechanism

What are common challenges in fnx1 gene targeting and how can they be addressed?

Researchers frequently encounter difficulties when attempting to manipulate the fnx1 locus, which can be addressed with specific strategies:

Low Targeting Efficiency:

Some genomic loci in S. pombe, potentially including fnx1, can show targeting rates below 5%, significantly limiting experimental progress. Evidence suggests several effective countermeasures:

  • Use the modified transformation procedure with antibiotic-based dominant selection markers, which can increase efficiency up to 5-fold

  • Construct targeting vectors with extended homology regions (beyond typical PCR-based cassettes)

  • Utilize background strains with deleted Pku70/Pku80 components to reduce competition from non-homologous end joining

Phenotypic Confirmation:

Confirming successful targeting through phenotypic analysis is essential. For fnx1, researchers should verify:

  • Altered response to nitrogen starvation in deletion mutants

  • Changes in heat shock resistance, which serves as a reliable phenotypic marker

  • Modified cell morphology under nitrogen limitation conditions

These phenotypic validations are particularly important given the central role of fnx1 in nitrogen starvation responses and the possibility of partial function retention in some genetic constructs .

How can researchers distinguish between direct and indirect effects of fnx1 manipulation?

When studying fnx1 function through overexpression or deletion, distinguishing direct effects from secondary consequences presents a significant challenge:

Temporal Analysis:

Monitor the sequence and timing of phenotypic changes following fnx1 induction or deletion. Direct effects should manifest earlier than downstream consequences. The literature demonstrates that fnx1+ RNA levels increase "sharply soon after the shift to media lacking nitrogen," suggesting rapid transcriptional activation is a direct response .

Inducible Expression Systems:

Utilize systems allowing tight control of fnx1 expression, such as the nmt promoters (nmt81, nmt41) mentioned in the literature. These enable researchers to observe immediate effects of fnx1 induction or repression .

Separation of Function Mutations:

Generate targeted mutations in fnx1 that affect specific domains or functions rather than complete deletion or overexpression. This approach can help isolate particular aspects of fnx1 activity and their respective phenotypic consequences.

Epistasis Analysis:

Determine whether the effects of fnx1 manipulation depend on the presence of other factors by conducting genetic interaction studies. This approach can reveal whether fnx1 acts upstream or downstream of other components in the nitrogen starvation response pathway.

What considerations are important when interpreting cell survival data in fnx1 studies?

Survival assays are crucial for understanding fnx1's role in long-term viability during nitrogen starvation, but several factors must be considered for proper interpretation:

Experimental Design Considerations:

The literature describes specific protocols that have successfully demonstrated fnx1's impact on survival:

  • Growth conditions: Cells should be grown to mid-logarithmic phase (e.g., 2 × 10^6 cells/ml) before nitrogen starvation

  • Starvation duration: Extended periods (e.g., 21 days) at appropriate temperature (32°C) with constant shaking

  • Replicate plating: Multiple independent experiments with triplicate plating for statistical validity

Cell Density Effects:

The density at which cells are subjected to nitrogen starvation significantly impacts their response. Experiments examining wild-type and Δfnx1 cells at different densities (e.g., starting at 2 × 10^7/ml with 10-fold serial dilutions) reveal density-dependent effects that could confound results if not properly controlled .

Assessment Methods:

Survival can be measured through:

  • Efficiency of plating determinations on nutrient-rich media

  • Recovery after stress treatment (e.g., heat shock for 20 min at 50°C)

Both approaches provide complementary information about the cells' ability to maintain viability and resume proliferation after extended nutrient limitation.

How might systems biology approaches advance understanding of fnx1 function?

The complexity of fnx1's role in nitrogen starvation response and potentially in cell-to-cell communication calls for integrated systems approaches:

Multi-omics Integration:

Combining transcriptomics, proteomics, metabolomics, and lipidomics data from wild-type, fnx1-overexpressing, and Δfnx1 strains under various nutritional conditions can provide a comprehensive view of the cellular changes mediated by fnx1. This approach may reveal unexpected connections between fnx1 and other cellular processes.

Network Analysis:

Constructing protein-protein interaction networks, genetic interaction maps, and metabolic networks centered around fnx1 can place this protein within the larger context of cellular function and identify key nodes that interact with or depend on fnx1 activity.

Mathematical Modeling:

Developing computational models of the nitrogen starvation response that incorporate fnx1 function can generate testable predictions about system behavior under various conditions and perturbations. Such models could be particularly valuable for understanding the dynamics of cell-to-cell communication processes.

What are promising approaches for investigating fnx1's proposed role in cell-to-cell communication?

The hypothesis that fnx1+ may facilitate "the release of a signaling substance into the environment as a means of cell-to-cell communication" presents exciting research opportunities :

Conditioned Media Experiments:

Transfer media from wild-type cells undergoing nitrogen starvation to fresh Δfnx1 cultures and assess whether this can rescue the defective starvation response. Fractionation of conditioned media could help identify the putative signaling molecules.

Co-culture Systems:

Develop microfluidic devices or other co-culture systems that allow physical separation of different cell populations while permitting exchange of soluble factors. This approach could determine whether wild-type cells can "rescue" nearby Δfnx1 cells through diffusible signals.

Biosensor Development:

Engineer reporter strains that produce detectable signals (fluorescence, luminescence) in response to specific aspects of the nitrogen starvation response. These biosensors could be used to visualize cell-to-cell communication in real-time within mixed populations.

Quorum Sensing Analysis:

Investigate whether the fnx1-mediated response exhibits density-dependent properties characteristic of quorum sensing systems. The cell density experiments described in the literature provide initial evidence suggesting such behavior might occur .

How does understanding fnx1 contribute to knowledge of microbial adaptation strategies?

Research on fnx1 extends beyond its specific molecular function to inform our understanding of how microorganisms adapt to fluctuating environments:

Most microorganisms naturally experience nutrient limitation in their habitats and have evolved sophisticated mechanisms to detect and respond to these conditions. The fnx1-mediated response to nitrogen starvation represents a specific adaptation that enables S. pombe to survive under challenging conditions .

By elucidating how fnx1 contributes to this response—potentially through facilitating cell-to-cell communication—researchers gain insights into the collective behaviors that microbial populations may employ to enhance survival. These mechanisms may be conserved across diverse species and environments, contributing to our fundamental understanding of microbial ecology .

What implications does fnx1 research have for understanding stress responses in other organisms?

While the specific function of fnx1 may be specialized for S. pombe, the principles revealed through its study have broader implications:

The role of membrane transporters in stress signaling is a recurring theme across biological systems. The finding that fnx1, a member of the MDR transporter family, plays a crucial role in the nitrogen starvation response highlights the diverse functions these transporters can serve beyond their classical roles in drug efflux .

The potential involvement of fnx1 in cell-to-cell communication during stress response also connects to emerging themes in microbial stress biology, where coordinated population-level responses are increasingly recognized as important survival strategies. These principles may inform research in other fungal species, bacteria, and potentially even higher eukaryotes where similar coordination mechanisms might operate .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.