Recombinant Schizosaccharomyces pombe NADH-cytochrome b5 reductase 1 (cbr1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe NADH-Cytochrome b5 Reductase 1 (cbr1)

Recombinant Schizosaccharomyces pombe NADH-cytochrome b5 reductase 1 (cbr1) is a genetically engineered protein derived from the fission yeast S. pombe. This enzyme facilitates electron transfer from NADH to cytochrome b5, a critical step in various metabolic pathways, including fatty acid desaturation and oxidative stress responses . The protein is encoded by the gene SPCC970.03 (also referred to as cbr1) and is classified under EC number 1.6.2.2 .

Key Features

ParameterDescription
Gene IDSPCC970.03, cbr1
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (determined by SDS-PAGE)
Protein LengthFull-length (exact amino acid count not specified in available sources)
TagNot explicitly mentioned (common tags include His or GST)

The enzyme belongs to the cytochrome b5 reductase family, characterized by a flavoprotein structure with FAD/FMN-binding domains . In eukaryotes, these reductases are typically membrane-bound and localize to the endoplasmic reticulum, where they interact with cytochrome b5 to mediate electron transport .

Expression Hosts

The recombinant protein is produced in diverse systems, including bacterial (E. coli), yeast, baculovirus, and mammalian cells . Host selection influences post-translational modifications and membrane integration.

Purification Methods

  1. Solubilization: Detergents like cholic acid are used to extract membrane-bound proteins .

  2. Chromatography: Affinity purification (e.g., DEAE-Sephacel, Mono-Q) and AMP-Sepharose chromatography isolate the enzyme .

  3. Activity Assays: NADH-dependent ferricyanide reduction is a common method to validate enzymatic function .

Potential Uses

ApplicationDescription
Metabolic EngineeringStudying lipid biosynthesis pathways (e.g., fatty acid desaturation)
Enzyme KineticsDetermining substrate specificity (NADH vs. NADPH) and redox potentials
Pathogen StudiesInvestigating virulence mechanisms in fungal pathogens (e.g., Zymoseptoria tritici)

Limitations

  • Host-Specific Variability: Expression in heterologous systems (e.g., E. coli) may yield misfolded or inactive protein due to codon bias or improper membrane integration .

  • Low Yield: Purification steps often result in significant activity loss, as seen in Mortierella alpina CbR studies .

Comparative Analysis with Related Proteins

OrganismGene NameEC NumberKey FunctionSource
Schizosaccharomyces pombecbr11.6.2.2NADH → cytochrome b5 electron transfer
Saccharomyces cerevisiaeCBR11.6.2.2Essential for membrane protein stability
Arabidopsis thalianaCBR11.6.2.2Pollen tube elongation, seed maturation
Mortierella alpinaCbR1.6.2.2Fatty acid desaturation (arachidonic acid)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
cbr1; SPCC970.03; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cbr1
Target Protein Sequence
MAKQTLLSTPLHGVYIPVFLIIFGTYIVKREWVGYAIVVAFSLGFHKFWRGRVRKVLSDK IQQFELSDKAVLNHNTAIYRFRLPRANDVLGLPIGQHLKVFVDVDGKEYSRSYTPLSSDA DKGYFDLLVKSYPNGKVSKKFSELKIGDTIGVRGPKGNWKHRTGLARHFGMIAGGTGITP MLQIIRAVLSNFEDPTEITLLYANVSEGDIVLRDEIDALAKKDPRFTVHYVLNNPPENWK GSVGFVTQELIKAHFPAPSPETKVLICGPTPMVNSLREATVALGYEKSRAISKLEDQVFV F
Uniprot No.

Target Background

Function
Recombinant Schizosaccharomyces pombe NADH-cytochrome b5 reductase 1 (cbr1) functions as an electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is essential for the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of cytochrome b5 reductase in S. pombe?

Cytochrome b5 reductase (cbr1) in S. pombe is a NADH-dependent flavoprotein that catalyzes the reduction of ferricytochrome b5 (Fe³⁺) to ferrocytochrome b5 (Fe²⁺). The enzyme contains flavin adenine dinucleotide (FAD) as a cofactor and primarily utilizes NADH as an electron donor. In S. pombe, cbr1 participates in electron transfer systems that support various cellular processes including lipid metabolism and sterol biosynthesis. The general reaction catalyzed can be represented as:

2 ferricytochrome b5 + NADH → 2 ferrocytochrome b5 + NAD⁺

This enzyme exists in different forms due to alternative splicing, resulting in both membrane-bound and soluble isoforms with potentially distinct cellular functions .

How does cbr1 differ structurally and functionally from cbr2 in S. pombe?

Based on experimental evidence, cbr1 and cbr2 in S. pombe appear to have distinct functional roles despite their structural similarities. Molecular characterization indicates that cbr1 is specifically involved in class II P450 systems, whereas cbr2 does not show significant involvement in these systems. This functional distinction is supported by cytochrome c reductase activity assays, where mutations in the CBR.1 gene resulted in reduced NADH-dependent cytochrome c reductase activity, while CBR.2 mutations did not show significant differences compared to wild-type strains .

Additionally, transcriptional analysis revealed that CBR.1 and CYB5 (cytochrome b5) transcript levels increased in crtR- mutant strains, suggesting a compensatory mechanism when the primary electron transfer system is compromised. In contrast, CBR.2 transcript levels remained relatively stable across different mutant strains, further indicating its minimal role in the cytochrome P450 electron transfer systems .

What role does cbr1 play in the electron transfer systems of S. pombe?

In S. pombe, cbr1 functions as an alternative electron donor to P450 enzymes, particularly in sterol biosynthesis pathways. Research has demonstrated that in strains with mutations in the crtR gene (which encodes cytochrome P450 reductase), there is an increase in NADH-dependent cytochrome c reductase activity accompanied by elevated transcript levels of CBR.1 and CYB5 genes .

This observation suggests that the CBR.1-CYB5 system can serve as a compensatory electron transfer mechanism when the primary NADPH-dependent system (involving crtR) is compromised. The electron transfer pathway likely involves:

  • Electron capture from NADH by cbr1

  • Transfer to cytochrome b5 (CYB5)

  • Subsequent donation to cytochrome P450 enzymes involved in sterol biosynthesis

This alternative pathway ensures continued functionality of essential metabolic processes even when the primary electron donor system is impaired .

What are the recommended methods for measuring cbr1 enzyme activity in S. pombe?

The cytochrome c reductase activity assay is the standard approach for evaluating cbr1 enzyme activity in S. pombe. This assay measures the ability of cbr1 to transfer electrons from NADH to cytochrome c, an artificial substrate that serves as a proxy for the enzyme's natural electron acceptors. The protocol involves:

  • Preparation of microsomal fractions from S. pombe cultures at specific growth phases (e.g., 36h and 72h)

  • Incubation of microsomes with cytochrome c in the presence of either NADH or NADPH

  • Spectrophotometric measurement of reduced cytochrome c formation

  • Calculation of enzyme activity based on the rate of cytochrome c reduction

When interpreting results, it's important to note that wild-type S. pombe microsomes typically show higher cytochrome c reductase activity with NADPH compared to NADH, while strains with mutations in cytochrome P450 reductase (crtR-) exhibit the opposite pattern. This assay allows researchers to differentiate between NADPH-dependent (primarily through CPR) and NADH-dependent (primarily through cbr1-CYB5) electron transfer pathways .

How should researchers design gene replacement experiments to study cbr1 function?

To effectively study cbr1 function through gene replacement experiments in S. pombe, the following methodological approach is recommended:

  • Vector Construction:

    • Design vectors containing antibiotic resistance markers (e.g., hygromycin B or zeocin) flanked by homologous sequences to the CBR.1 gene

    • Include at least 500-1000 bp of homologous sequence on each side of the marker for efficient recombination

  • Transformation and Selection:

    • Transform S. pombe cells with the linearized construct using standard protocols

    • Select transformants on media containing the appropriate antibiotic

    • Verify integration using PCR-based genotype analysis

  • Verification of Hemizygosity/Homozygosity:

    • Perform PCR analyses with primers specific to both the wild-type gene and the insertion

    • Consider that S. pombe strains may be aneuploid, requiring careful verification of mutant status

  • Phenotypic Analysis:

    • Examine growth characteristics at different time points

    • Analyze metabolite production (e.g., sterols) using appropriate extraction and quantification methods

    • Perform enzyme activity assays with microsomal fractions

For comprehensive analysis, researchers should compare the cbr1 mutant with both wild-type strains and mutants of related genes (such as cbr2 or crtR) to identify specific functional roles and potential compensatory mechanisms .

What expression systems and purification methods are most effective for producing recombinant S. pombe cbr1?

For recombinant production of S. pombe cbr1, the following expression and purification approach is recommended:

Expression Systems:

  • E. coli Systems:

    • BL21(DE3) with pET-based vectors for high-level expression

    • Use of cold-shock promoters and low-temperature induction (16-18°C) to enhance proper folding

    • Co-expression with chaperones may improve solubility

  • Yeast Expression Systems:

    • S. cerevisiae or Pichia pastoris systems for proper post-translational modifications

    • Use of strong inducible promoters (GAL1 for S. cerevisiae, AOX1 for P. pastoris)

Purification Protocol:

  • Cell lysis using mechanical disruption (French press or sonication) in buffer containing:

    • 50 mM sodium phosphate or Tris-HCl (pH 7.0-7.5)

    • 300 mM NaCl

    • 10% glycerol

    • 1 mM PMSF and protease inhibitor cocktail

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Elution with imidazole gradient (50-300 mM)

  • Ion exchange chromatography:

    • DEAE or Q-Sepharose columns for further purification

    • Elution with NaCl gradient (0-500 mM)

  • Size exclusion chromatography as a final polishing step

Throughout purification, maintain reducing conditions (typically 1-5 mM DTT or β-mercaptoethanol) to preserve enzyme activity. Monitor purification using SDS-PAGE and enzyme activity assays with cytochrome c as substrate. The final preparation should be stored with 20% glycerol at -80°C for long-term stability .

How can researchers accurately assess the relative contributions of NADH vs. NADPH electron transfer pathways in S. pombe microsomal preparations?

To accurately assess the relative contributions of NADH vs. NADPH electron transfer pathways in S. pombe microsomes, researchers should implement a comprehensive analytical approach:

Experimental Protocol:

  • Preparation of High-Quality Microsomes:

    • Harvest cells at multiple time points (e.g., 36h and 72h of cultivation)

    • Employ differential centrifugation with sucrose gradient purification

    • Verify microsomal fraction purity by marker enzyme assays

  • Parallel Activity Assays:

    • Conduct cytochrome c reductase assays using both NADH and NADPH as electron donors

    • Perform assays in triplicate under identical conditions (pH, temperature, substrate concentration)

    • Include appropriate controls (boiled enzyme, no cofactor)

  • Inhibitor Studies:

    • Use specific inhibitors for CBR (e.g., diphenyleneiodonium) and CPR (e.g., diphenyliodonium chloride)

    • Measure residual activity to determine pathway-specific contributions

Data Analysis and Interpretation:
Based on published data, wild-type S. pombe typically shows higher cytochrome c reductase activity with NADPH than with NADH, reflecting predominant CPR activity. Conversely, crtR- mutants exhibit higher activity with NADH than with NADPH, indicating enhanced CBR-CYB5 pathway function .

The following table summarizes typical activity patterns observed in different S. pombe strains:

StrainNADPH-dependent activityNADH-dependent activityInterpretation
Wild-typeHigher (+++++)Lower (++)Normal CPR dominance
crtR-Lower (++)Higher (++++)Enhanced CBR-CYB5 compensation
cbr1-Higher (++++)Significantly reduced (+)Impaired NADH pathway
cbr2-Higher (++++)Similar to wild-type (++)CBR2 not significantly involved

When analyzing results, researchers should normalize activities to protein concentration and express them as relative percentages to facilitate comparison across strains. The presence of significantly altered NADH-dependent activity in cbr1- mutants, but not in cbr2- mutants, provides strong evidence for the specific involvement of CBR1 in the alternative electron transfer pathway .

What approaches should be used to resolve contradictory findings regarding cbr1 function in different experimental setups?

When faced with contradictory findings regarding cbr1 function across different experimental setups, researchers should implement a systematic troubleshooting approach:

Methodological Reconciliation Strategy:

  • Strain Background Analysis:

    • Verify genetic backgrounds of all strains used

    • Determine ploidy status, as S. pombe strains can be aneuploid

    • Sequence the CBR.1 gene to identify potential polymorphisms

  • Experimental Condition Standardization:

    • Standardize growth conditions (media composition, temperature, aeration)

    • Establish consistent time points for sampling

    • Control for growth phase effects by monitoring growth curves

  • Multi-omics Integration:

    • Combine transcriptomic data (RT-qPCR of CBR.1, CBR.2, CYB5)

    • Correlate transcript levels with enzyme activity measurements

    • Incorporate metabolomic analysis of end products (sterols, carotenoids)

The research data suggests that timing is critical - significant differences in CBR.1 and CYB5 transcript levels between wild-type and mutant strains were observed at 72h but not at 36h of cultivation . This indicates that growth phase can substantially impact experimental outcomes.

Additionally, the presence of alternative pathways and compensatory mechanisms complicates interpretation. For example, in crtR- mutants, increased CBR.1 and CYB5 transcript levels coincide with higher NADH-dependent cytochrome c reductase activity, suggesting pathway compensation .

To resolve contradictions, researchers should directly test hypotheses through epistasis analysis by creating double mutants (e.g., crtR-/cbr1-) and measuring both molecular (transcript levels) and functional (enzyme activity, metabolite production) outcomes under standardized conditions.

How does the electron transfer mechanism of cbr1-CYB5 differ from the CPR pathway in cytochrome P450 systems?

The electron transfer mechanisms of cbr1-CYB5 and CPR pathways in cytochrome P450 systems exhibit fundamental differences in cofactor preference, electron flow, and regulatory control:

Electron Transfer Pathways Comparison:

  • Cofactor Utilization:

    • CPR pathway: Primarily utilizes NADPH as electron donor

    • cbr1-CYB5 pathway: Primarily utilizes NADH as electron donor

  • Electron Flow Mechanism:

    • CPR pathway: NADPH → CPR (FAD/FMN) → P450

    • cbr1-CYB5 pathway: NADH → cbr1 (FAD) → CYB5 → P450

  • Kinetic Parameters:
    The cytochrome c reductase assay reveals distinct kinetic behaviors:

    ParameterCPR Pathwaycbr1-CYB5 Pathway
    Preferred cofactorNADPHNADH
    Relative activity in wild-typeHigherLower
    Activity in crtR- mutantSignificantly reducedEnhanced
  • Compensatory Regulation:
    Research demonstrates that when the primary CPR pathway is compromised (as in crtR- mutants), the cbr1-CYB5 pathway shows enhanced activity. This is evidenced by:

    • Increased transcript levels of CBR.1 and CYB5 genes

    • Higher NADH-dependent cytochrome c reductase activity

    • Maintained (though reduced) sterol production despite CPR deficiency

This compensatory relationship suggests that while the CPR pathway dominates under normal conditions, the cbr1-CYB5 system serves as an alternative electron donor pathway that can be upregulated when needed. The molecular basis for this regulation appears to involve transcriptional control of CBR.1 and CYB5 genes, as their expression levels increase in crtR- mutant strains after 72h of cultivation .

The exact coupling mechanism between cbr1-CYB5 and P450 enzymes may involve direct electron transfer from CYB5 to P450 or a more complex interaction involving additional protein factors, an area that warrants further investigation.

What are the most common challenges in expressing functional recombinant S. pombe cbr1, and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant S. pombe cbr1. Here are the most common issues and their solutions:

Challenge 1: Low Expression Levels

  • Cause: Codon usage bias, inefficient promoters, or toxicity to host cells

  • Solution:

    • Optimize codons for the expression host

    • Use strong inducible promoters (T7 for E. coli; GAL1 for yeast)

    • Implement auto-induction media systems

    • Test multiple expression strains (BL21, Rosetta, etc.)

Challenge 2: Protein Insolubility

  • Cause: Improper protein folding, membrane association, aggregation

  • Solution:

    • Lower induction temperature (16-18°C)

    • Add solubility enhancers to lysis buffer (0.1% Triton X-100, 10% glycerol)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK)

    • Express truncated versions lacking membrane-binding domains for soluble variants

Challenge 3: Loss of FAD Cofactor

  • Cause: Dissociation during purification

  • Solution:

    • Supplement purification buffers with 10-20 μM FAD

    • Include FAD during dialysis and storage

    • Verify FAD content spectrophotometrically (A450/A280 ratio)

Challenge 4: Low Enzyme Activity

  • Cause: Improper folding, cofactor loss, oxidative damage

  • Solution:

    • Maintain reducing conditions throughout purification (1-5 mM DTT)

    • Include antioxidants in storage buffer (1 mM ascorbate)

    • Verify functional integrity through cytochrome c reductase assays

    • Optimize buffer conditions (pH 7.0-7.5 typically optimal)

Methodological Approach to Verify Functional Expression:
After purification, always verify functional integrity through:

  • Spectral analysis (characteristic flavoprotein absorbance at 450-460 nm)

  • Cytochrome c reductase activity assays with both NADH and NADPH

  • Western blot analysis with antibodies against cbr1 or affinity tags

By systematically addressing these challenges, researchers can significantly improve the yield and quality of functional recombinant S. pombe cbr1 for subsequent studies .

How should researchers interpret changes in cbr1 activity when investigating different genetic backgrounds or environmental conditions?

Interpreting changes in cbr1 activity across different genetic backgrounds or environmental conditions requires careful consideration of multiple factors:

Analytical Framework for Interpretation:

  • Baseline Comparison:

    • Always compare cbr1 activity in experimental conditions to appropriate controls

    • Wild-type strains typically show higher NADPH-dependent than NADH-dependent activity

    • Changes in this ratio may indicate altered pathway utilization

  • Gene Expression Correlation:

    • Analyze transcript levels of CBR.1, CYB5, and related genes using RT-qPCR

    • The research shows that changes in enzyme activity often correlate with transcript levels

    • For example, crtR- mutants exhibit both higher CBR.1/CYB5 transcript levels and increased NADH-dependent activity

  • Growth Phase Considerations:

    • Activity patterns and gene expression can vary significantly with growth phase

    • In the published research, differences in transcript levels between wild-type and crtR- strains were only observed at 72h, not at 36h

    • Always sample at multiple time points to capture dynamic changes

  • Compensatory Mechanism Analysis:
    When examining specific mutants:

    Genetic BackgroundExpected cbr1 Activity PatternInterpretation
    Wild-typeHigher NADPH-dependent activityNormal CPR dominance
    crtR-Higher NADH-dependent activityCBR-CYB5 compensation activated
    cbr1-Reduced NADH-dependent activityConfirms CBR1's role in NADH pathway
    cbr2-Minimal effect on NADH activityCBR2 not significantly involved
  • Environmental Factors:

    • Nutrient availability may affect electron transfer preferences

    • Oxidative stress could influence the FAD redox state and enzyme activity

    • Temperature changes may alter membrane fluidity and affect membrane-bound isoforms

When interpreting results that deviate from expected patterns, consider:

  • Potential post-translational modifications affecting enzyme activity

  • Protein-protein interactions that might modulate electron transfer efficiency

  • Feedback regulation mechanisms responding to cellular redox state

  • Subcellular localization changes affecting substrate accessibility

What advanced analytical techniques can help elucidate the structural basis for cbr1 function in electron transfer systems?

To comprehensively elucidate the structural basis of cbr1 function in electron transfer systems, researchers should consider implementing the following advanced analytical techniques:

Structural Analysis Techniques:

  • X-ray Crystallography:

    • Express and purify recombinant cbr1 with high homogeneity

    • Screen crystallization conditions with and without NADH/FAD cofactors

    • Determine atomic-resolution structures to identify key catalytic residues

    • Co-crystallize with interaction partners (e.g., CYB5) to characterize binding interfaces

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly useful for membrane-associated forms of cbr1

    • Analyze cbr1-CYB5-P450 complexes in near-native states

    • Visualize conformational changes during electron transfer events

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map protein dynamics and conformational changes upon cofactor binding

    • Identify regions involved in protein-protein interactions

    • Characterize differences between active and inactive states

  • Site-Directed Mutagenesis Combined with Activity Assays:

    • Create targeted mutations of predicted catalytic residues

    • Assess the impact on NADH binding, FAD reduction, and electron transfer

    • A systematic alanine scanning approach can identify essential residues

Advanced Spectroscopic Methods:

  • Transient Kinetic Analyses:

    • Stopped-flow spectroscopy to measure the rates of individual electron transfer steps

    • Pre-steady-state kinetics to identify rate-limiting steps in the catalytic cycle

    • Temperature-dependent measurements to determine activation energies

  • Electron Paramagnetic Resonance (EPR):

    • Characterize the electronic states of FAD during catalysis

    • Monitor formation and decay of radical intermediates

    • Determine distances between redox centers using DEER-EPR

Computational Approaches:

  • Molecular Dynamics Simulations:

    • Model the dynamic behavior of cbr1 in solution and membrane environments

    • Simulate electron transfer pathways between redox centers

    • Predict the effects of mutations on protein stability and function

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Calculate electronic properties of the FAD cofactor and active site

    • Predict electron transfer rates based on Marcus theory

    • Identify optimal electron tunneling pathways

By integrating these complementary approaches, researchers can develop a comprehensive understanding of the structural basis for cbr1 function, including the mechanisms of NADH binding, FAD reduction, protein-protein interactions with CYB5, and subsequent electron transfer to P450 enzymes .

How does S. pombe cbr1 compare functionally with cytochrome b5 reductases from other species?

S. pombe cbr1 shares core functionality with cytochrome b5 reductases from other species but exhibits distinct characteristics that reflect evolutionary adaptation to specific cellular contexts:

Comparative Functional Analysis:

  • Cofactor Preference:

    • S. pombe cbr1: Primarily utilizes NADH as electron donor

    • Mammalian cytochrome b5 reductases: Similarly NADH-dependent

    • Some fungal homologs: Can utilize both NADH and NADPH with varying efficiency

  • Cellular Roles:

    SpeciesPrimary Physiological RolesUnique Features
    S. pombeSterol biosynthesis, lipid metabolismCompensatory role in P450 systems when CPR is deficient
    S. cerevisiaeErgosterol biosynthesis, fatty acid desaturationTwo distinct reductases with specialized functions
    MammalsFatty acid metabolism, methemoglobin reductionGenetic deficiency causes methemoglobinemia
    X. dendrorhousSterol/carotenoid biosynthesisCBR.1 specifically involved in class II P450 systems
  • Electron Transfer Partners:

    • S. pombe cbr1 interacts with cytochrome b5 (CYB5) to form an alternative electron donor system for P450 enzymes

    • In mammals, cytochrome b5 reductase reduces cytochrome b5, which can then modulate P450 activity or directly participate in fatty acid desaturation

    • The research shows that in X. dendrorhous, CBR.1 (but not CBR.2) participates in the CBR-CYB5 electron transfer pathway

  • Compensatory Mechanisms:
    The compensatory upregulation of the CBR.1-CYB5 pathway observed in S. pombe when the primary CPR pathway is compromised appears to be a conserved feature across several fungal species. This functional redundancy suggests evolutionary pressure to maintain crucial electron transfer processes for vital cellular functions like sterol biosynthesis .

The functional specialization of cbr1 in S. pombe, particularly its involvement in specific P450-dependent pathways, reflects the evolutionary adaptation of electron transfer systems to meet the metabolic demands of different organisms while maintaining core enzymatic mechanisms for electron transfer from NADH to cytochrome b5 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.