Recombinant Schizosaccharomyces pombe NADPH--cytochrome P450 reductase (ccr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccr1; SPBC29A10.01; SPBC365.17; NADPH--cytochrome P450 reductase; CPR; P450R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
Target Protein Sequence
MKTYEYVLLVIILILSLCYFIYNNFLNKPKAPERRVVATDSIVELMEAEKLTAAVFFGSQTGTAEDFAYRFSTEAKANFNLTNMVFDLENYDLTDLDNFDRSKLLVFFLATYGEGEPTDNAEAFLQLLEGDDTVFSSGKGIEDTPFEGIRYAIFGLGNHTYEYYNAMAKKVDAAMTRLGATRVGNLGLGDDAAGMLEEDYLQWKDDTLPEIGKLFHLQEVHKEYNPMFEVIEKPEISNTSSTVFLGEPSRQQLKGNVASKAPRSQANPFFSSPVRSLELFKSGSRNCLHLELDIADSGMRYQTGDYASICPMNPSQAVDDLLEVLGLKEKRDTVIIVKPIDTLDKAPVLSPTTYDTVFRYYYEICGIVSRQLLSFIAPFAPTPESKQELEKLGNDYDYFKKNVVDLHLNLAQVLRRVSPDAPFTKLPFSMLLENMAHMKPRYYSISSSSVVHPDKVHVTAVVDKKEWTDKNHIFYGLTTNYLLAHCRHMHGEKIPHPNGLEYTLEGPRKNWTGKIPMFVKKSTFRLAPPDVPIIMVGPGTGVAPFRGFVMERANLASKGVKVAKTLLFYGCQYSDKDFLYKEEWQQYKDVLKDSFELITAFSREQDHKIYVQHRLLEHSDTIAKLVEEGAAFYICGDADHMAKDVVNALASILTTVDVDGMKAVKALRDDNRFFEDTW
Uniprot No.

Target Background

Function
This enzyme is essential for electron transfer from NADP to cytochrome P450 in microsomes. It also facilitates electron transfer to heme oxygenase and cytochrome B5. This enzyme is involved in ergosterol biosynthesis.
Database Links
Protein Families
NADPH--cytochrome P450 reductase family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Mitochondrion outer membrane; Single-pass membrane protein; Cytoplasmic side. Cell membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is Schizosaccharomyces pombe NADPH-cytochrome P450 reductase (ccr1) and how was it initially characterized?

Schizosaccharomyces pombe NADPH-cytochrome P450 reductase, encoded by the gene ccr1+ (previously known as cls1+), is a key enzyme that functions in electron transfer reactions in the fission yeast. The ccr1 gene was initially cloned by complementation of the clotrimazole-sensitive growth defect of cls1/ccr1-1 mutant cells . Nucleotide sequencing revealed that ccr1+ is identical to the gene SPBC29A10.01, which encodes a protein of 678 amino acids .

The characterization method involved:

  • Isolation of mutants with sensitivity to antifungal agents

  • Complementation analysis to identify the responsible gene

  • Nucleotide sequencing and homology comparison

  • Linkage analysis to confirm allelism between ccr1+ and the cls1 mutation

These approaches established that cls1 and ccr1 were the same gene, leading to the renaming of cls1 as ccr1-1 .

What is the structural homology of S. pombe ccr1 with related enzymes from other organisms?

S. pombe ccr1 shows significant structural conservation with NADPH-cytochrome P450 reductases from other species:

OrganismHomologous ProteinSequence IdentityFunction
HumansPOR (P450 Oxidoreductase)37%Electron transfer to P450 enzymes
Saccharomyces cerevisiaeNcp1p38%Cell wall assembly, electron transfer
Candida albicansNADPH-cytochrome P450 reductaseNot specifiedCell wall integrity

This conservation indicates the evolutionary importance of this enzyme family across fungal and mammalian species . The moderate sequence identity (37-38%) suggests sufficient conservation of catalytic domains while allowing for species-specific regulatory mechanisms and interactions.

What phenotypes are associated with ccr1 deletion in S. pombe?

Deletion of ccr1 in S. pombe results in various pleiotropic phenotypes that highlight its multifunctional role:

Phenotype CategorySpecific Manifestations in Δccr1 Cells
Drug SensitivityHypersensitivity to antifungal drugs (azoles, terbinafine, micafungin), immunosuppressor FK506, anticancer drugs (tamoxifen, 5-fluorouracil)
Cell StructureDefects in cell wall integrity
Organelle FunctionVacuole fusion abnormalities
SignalingEnhanced calcineurin activity
Ion HomeostasisIncreased intracellular Ca2+ levels
Protein LocalizationNuclear accumulation of Prz1 (calcineurin-responsive transcription factor)

These diverse phenotypes indicate that ccr1 is involved in multiple cellular processes, particularly those related to stress response, membrane integrity, and calcium signaling . Importantly, Δccr1 cells remain viable, suggesting that while ccr1 is important for normal cellular function, it is not essential for survival under standard laboratory conditions.

What is the molecular mechanism of tamoxifen's interaction with ccr1?

Tamoxifen (TAM) interacts with ccr1 through direct inhibition of its NADPH-cytochrome P450 reductase activity. The molecular mechanism involves:

  • Dose-dependent inhibition: Experimental data demonstrates that tamoxifen inhibits NADPH-cytochrome P450 reductase activities in a concentration-dependent manner .

  • Specificity of interaction: Overexpression of ccr1 causes resistance specifically to tamoxifen but not to other tested drugs, indicating a selective interaction between tamoxifen and ccr1 .

  • Phenocopy effect: TAM treatment of wild-type cells results in pleiotropic phenotypes similar to those observed in cells lacking ccr1, supporting the hypothesis that TAM acts by inhibiting ccr1 function .

The inhibition curve of NADPH-cytochrome P450 reductase activity shows a progressive decrease as tamoxifen concentration increases, suggesting a direct binding interaction rather than an indirect regulatory effect . This specific inhibition differs from TAM's known mechanisms in mammalian cells, where it primarily acts as an estrogen receptor modulator.

How does ccr1 contribute to cell wall integrity in S. pombe?

Ccr1 plays a crucial role in maintaining cell wall integrity in S. pombe through several interconnected pathways:

  • Regulation of cell wall components: Ccr1 likely influences the synthesis or modification of cell wall polysaccharides and proteins, as evidenced by the cell wall defects in Δccr1 cells .

  • Calcium signaling connection: The increased intracellular Ca2+ levels and enhanced calcineurin activity in Δccr1 cells suggest a relationship between ccr1, calcium homeostasis, and cell wall maintenance .

  • Signaling pathway interactions: The nuclear localization of GFP-Prz1 (a calcineurin-responsive transcription factor) in Δccr1 cells indicates that ccr1 deletion activates calcineurin-dependent transcriptional responses .

  • Drug sensitivity correlation: The hypersensitivity of Δccr1 cells to cell wall-targeting drugs (particularly azoles and micafungin) provides additional evidence for ccr1's role in cell wall integrity .

  • Conservation of function: The similar cell wall defects observed when TAM is applied to Candida albicans suggests that the role of NADPH-cytochrome P450 reductase in cell wall integrity is conserved across fungal species .

Research indicates that constitutively active calcineurin can suppress the drug-sensitive phenotypes of Δccr1 cells, suggesting that the calcineurin pathway acts downstream of or parallel to ccr1 in regulating cell wall integrity .

What are the optimal methods for expressing and purifying recombinant S. pombe ccr1 for structural and functional studies?

Based on existing research approaches with similar proteins, the following methodological workflow is recommended for recombinant ccr1 expression and purification:

  • Expression system selection:

    • E. coli: Use BL21(DE3) or Rosetta strains for high-yield expression

    • S. pombe: Consider homologous expression when post-translational modifications are critical

    • P. pastoris: For larger-scale production of properly folded eukaryotic protein

  • Vector design considerations:

    • Include affinity tags (His6 or GST) for purification

    • Add TEV protease cleavage site for tag removal

    • Consider codon optimization for the expression host

  • Expression optimization:

    • Temperature: 18-30°C (lower temperatures often improve folding)

    • Induction: IPTG concentration (0.1-1.0 mM) or methanol for P. pastoris

    • Duration: 4-24 hours depending on stability

    • Cofactor supplementation: Add riboflavin or FMN to media

  • Purification protocol:

    • Cell lysis: Sonication or French press in buffer containing protease inhibitors

    • Initial capture: Affinity chromatography (Ni-NTA for His-tagged protein)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer optimization: Include glycerol (10%) and reducing agents to maintain stability

  • Activity assessment:

    • NADPH consumption assay: Monitor decrease in absorbance at 340 nm

    • Cytochrome c reduction assay: Measure rate of cytochrome c reduction at 550 nm

    • Test inhibition by known compounds (e.g., tamoxifen) to confirm functional integrity

This methodological approach incorporates standard practices for recombinant protein production while addressing the specific challenges associated with flavoenzymes like NADPH-cytochrome P450 reductase.

How can researchers design experiments to investigate ccr1's role in drug resistance mechanisms?

To investigate ccr1's role in drug resistance, researchers should employ a multi-faceted experimental approach:

  • Genetic manipulation studies:

    • Create precise gene deletions (Δccr1) and point mutations in conserved domains

    • Develop strains with controlled ccr1 expression (inducible promoters)

    • Generate ccr1 overexpression systems to examine resistance phenotypes

    • Create chimeric proteins with domains from related reductases to map functional regions

  • Drug sensitivity profiling:

    • Perform comprehensive dose-response analyses with different drug classes

    • Measure minimal inhibitory concentrations (MICs) for wild-type, Δccr1, and ccr1-overexpressing strains

    • Conduct time-kill experiments to assess dynamic responses

    • Determine resistance development rates under selective pressure

  • Biochemical interaction studies:

    • Quantify enzyme inhibition kinetics with various drugs

    • Perform binding affinity measurements using isothermal titration calorimetry or surface plasmon resonance

    • Conduct structural analyses through crystallography or cryo-EM

    • Map binding sites through photoaffinity labeling or hydrogen-deuterium exchange

  • Cellular response analyses:

    • Monitor changes in cell wall composition using specific dyes and microscopy

    • Assess membrane integrity and permeability

    • Quantify intracellular drug accumulation

    • Measure reactive oxygen species levels and oxidative stress responses

  • Signaling pathway investigations:

    • Analyze calcineurin pathway activation using reporter systems

    • Perform phosphoproteomic analyses to identify altered signaling

    • Conduct genetic interaction screens to identify synthetic lethal or rescue interactions

    • Use transcriptomics to characterize global response patterns

These methodological approaches would provide comprehensive insights into how ccr1 contributes to drug resistance mechanisms, potentially revealing new targets for antifungal development.

What techniques are most effective for studying ccr1's interaction with the cell wall integrity pathway?

To effectively study ccr1's interaction with the cell wall integrity pathway, researchers should employ the following methodological approaches:

  • Cell wall integrity assays:

    • Sensitivity testing to cell wall stressors (Calcofluor White, Congo Red)

    • Enzymatic digestion resistance (β-glucanase, zymolyase)

    • Osmotic stress response evaluation

    • Electron microscopy to visualize cell wall ultrastructure

  • Signaling pathway analyses:

    • Western blotting to detect phosphorylation of Pmk1 MAPK (key cell wall integrity pathway component)

    • Transcriptional reporter assays for cell wall stress genes

    • Live-cell imaging of GFP-tagged signaling components

    • Calcium flux measurements using fluorescent indicators

  • Genetic interaction mapping:

    • Synthetic genetic array analysis with cell wall pathway mutants

    • Suppressor screens to identify genes that rescue ccr1 deletion phenotypes

    • Double mutant analyses with calcineurin pathway components

    • Epistasis studies to position ccr1 within the pathway hierarchy

  • Cell wall composition analysis:

    • HPLC quantification of glucan, mannan, and chitin content

    • Mass spectrometry of cell wall proteins

    • Fluorescent labeling of specific cell wall components

    • Atomic force microscopy to assess mechanical properties

  • Drug intervention studies:

    • Combination treatments with cell wall inhibitors and tamoxifen

    • Time-course analysis of gene expression during drug exposure

    • Competitive fitness assays under drug selection

    • Recovery rate measurement after drug withdrawal

These complementary approaches would provide a comprehensive understanding of how ccr1 integrates with the complex network of pathways maintaining cell wall integrity in S. pombe.

How can researchers accurately measure NADPH-cytochrome P450 reductase activity in S. pombe extracts?

Accurate measurement of NADPH-cytochrome P450 reductase activity in S. pombe extracts requires carefully optimized protocols:

  • Sample preparation:

    • Cell disruption: Glass bead lysis in buffer containing protease inhibitors

    • Membrane fraction isolation: Differential centrifugation (10,000×g to remove debris, 100,000×g to collect membranes)

    • Solubilization: Gentle detergents (0.5-1% Triton X-100 or CHAPS)

    • Storage: Aliquot and flash-freeze in buffer containing 20% glycerol

  • Spectrophotometric activity assays:

Assay TypePrincipleSubstrateMeasurement
NADPH ConsumptionDirect measurement of NADPH oxidationNADPHDecrease in absorbance at 340 nm
Cytochrome c ReductionElectron transfer to cytochrome cCytochrome cIncrease in absorbance at 550 nm
P450 ReductionFunctional coupling with P450 enzymesNADPH + P450Formation of reduced P450-CO complex at 450 nm
Artificial AcceptorElectron transfer to artificial acceptorsFerricyanide, MTT, NBTSpecific wavelength depending on acceptor
  • Assay conditions optimization:

    • Buffer composition: pH 7.4-7.8, 100 mM phosphate or HEPES

    • Temperature: 25-30°C (controlled water-jacketed cuvette)

    • NADPH concentration: 50-200 μM (non-limiting)

    • Protein concentration: Determined through preliminary linearity tests

    • Cofactor supplementation: FMN, FAD (0.1-1 μM)

  • Data analysis and validation:

    • Calculate specific activity (nmol substrate converted/min/mg protein)

    • Determine kinetic parameters (Km, Vmax) through Michaelis-Menten analysis

    • Perform inhibition studies with known inhibitors (e.g., tamoxifen)

    • Include positive controls (purified mammalian POR) and negative controls (heat-inactivated enzyme)

  • Troubleshooting common issues:

    • Low activity: Add reducing agents (DTT, β-mercaptoethanol), check for cofactor loss

    • High background: Include appropriate blanks, optimize protein concentration

    • Instability: Add glycerol, reduce temperature, minimize freeze-thaw cycles

    • Interference: Check for endogenous cytochrome c reductase activity from mitochondria

These methodological considerations ensure reliable and reproducible measurement of NADPH-cytochrome P450 reductase activity in complex S. pombe extracts .

What are the implications of ccr1's interactions with tamoxifen for antifungal drug development?

The discovery that tamoxifen inhibits S. pombe ccr1 and affects cell wall integrity has significant implications for antifungal drug development:

  • Drug repurposing potential:

    • Tamoxifen, an established anticancer drug with well-characterized pharmacokinetics and safety profiles, could be repurposed for antifungal applications .

    • The current study "provides a strong foundation for future efforts to optimize TAM for medicinal drug repurposing in the development of antifungal agents" .

  • Novel target validation:

    • NADPH-cytochrome P450 reductase represents a non-traditional antifungal target with a mechanism distinct from current antifungals .

    • The conservation of this target across fungal species (including pathogenic Candida albicans) suggests broad-spectrum potential .

  • Resistance management strategies:

    • Understanding how ccr1 overexpression confers tamoxifen resistance provides insights into potential resistance mechanisms .

    • Combination therapies targeting both ccr1 and downstream pathways (e.g., calcineurin) could prevent resistance development.

  • Structure-activity relationship opportunities:

    • Tamoxifen's structural framework could serve as a starting point for developing derivatives with enhanced antifungal activity and reduced estrogen receptor activity.

    • The dose-dependent inhibition data suggests structure-based drug design approaches could yield optimized inhibitors .

  • Pathway-informed drug discovery:

    • The connection between ccr1, calcium signaling, and cell wall integrity suggests that compounds targeting this pathway intersection may have synergistic effects with existing antifungals.

    • The finding that "overexpression of the constitutively active calcineurin suppressed the drug-sensitive phenotypes of the Δccr1 cells" provides mechanistic insights for rational drug design .

These research implications highlight ccr1 as a promising target for novel antifungal strategies, particularly important given the increasing prevalence of resistance to current antifungal drugs.

How can studying S. pombe ccr1 advance our understanding of human P450 oxidoreductase (POR) functions and disorders?

Research on S. pombe ccr1 provides valuable insights into human P450 oxidoreductase (POR) biology due to their evolutionary relationship (37% identity) :

  • Conserved structural and functional elements:

    • The significant sequence homology between ccr1 and human POR suggests conserved catalytic mechanisms and regulatory features .

    • S. pombe provides a simplified model system to study fundamental aspects of electron transfer in NADPH-cytochrome P450 reductases.

  • Disease-relevant mutations:

    • Mutations identified in human POR cause disorders of steroidogenesis and skeletal development.

    • Corresponding mutations can be introduced into S. pombe ccr1 to assess their effects on enzyme function in a cellular context.

    • This "humanized yeast" approach allows rapid screening of variants of unknown significance.

  • Drug interaction mechanisms:

    • The inhibition of ccr1 by tamoxifen suggests that human POR might similarly be affected by certain drugs .

    • This provides a model for studying how medications might inadvertently affect P450-dependent drug metabolism in humans.

  • Regulatory pathway conservation:

    • The links between ccr1 and calcium/calcineurin signaling in S. pombe may have parallels in mammalian systems .

    • Understanding these regulatory mechanisms could provide insights into tissue-specific modulation of human POR activity.

  • Structural biology advantages:

    • The ability to produce recombinant ccr1 provides opportunities for structural studies that may be applicable to human POR.

    • Crystallographic or cryo-EM structures of ccr1 with various ligands could inform structure-based drug design for human applications.

These translational aspects demonstrate how fundamental research on S. pombe ccr1 can contribute to our understanding of human P450 reductase biology and potentially lead to novel therapeutic approaches for POR-related disorders.

What are the most promising future research directions for S. pombe ccr1 studies?

The current knowledge about S. pombe ccr1 points to several promising research directions:

  • Structural biology and drug design:

    • Determination of high-resolution structures of ccr1 alone and in complex with inhibitors

    • Structure-guided optimization of tamoxifen derivatives as antifungal agents

    • Exploration of allosteric regulatory sites for selective targeting

  • Systems biology approaches:

    • Global genetic interaction screens to map ccr1's functional network

    • Metabolomic profiling to identify altered pathways in ccr1 mutants

    • Integrative multi-omics to understand ccr1's role in cellular homeostasis

  • Translational applications:

    • Testing tamoxifen and derivatives against clinical fungal isolates

    • Development of combination therapies targeting ccr1 and cell wall integrity

    • Exploration of biomarkers for ccr1-targeted therapy efficacy

  • Comparative studies across species:

    • Functional conservation analysis between S. pombe ccr1, C. albicans NADPH-cytochrome P450 reductase, and human POR

    • Evolutionary analysis of regulatory mechanisms across fungal species

    • Investigation of species-specific structural features for selective targeting

  • Advanced methodological development:

    • CRISPR-based approaches for precise genome editing of ccr1

    • Development of high-throughput screening platforms for ccr1 inhibitors

    • In vivo imaging techniques to visualize ccr1 activity in real-time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.