Recombinant Schizosaccharomyces pombe Nuclear envelope morphology protein 1 (nem1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Nuclear Envelope Morphology Protein 1 (nem1)

Recombinant Schizosaccharomyces pombe Nuclear Envelope Morphology Protein 1 (nem1) is a protein derived from the fission yeast Schizosaccharomyces pombe. This protein plays a crucial role in maintaining the structure and integrity of the nuclear envelope, which is essential for cellular processes such as mitosis and meiosis. The recombinant form of nem1 is produced through genetic engineering techniques, typically expressed in Escherichia coli (E. coli), and is used in various research applications to study nuclear envelope dynamics and cellular biology.

Characteristics of Recombinant nem1

  • Protein Length and Structure: The recombinant nem1 protein is a full-length protein consisting of 476 amino acids. It is often fused with a His-tag at the N-terminal for easy purification and detection .

  • Expression System: The protein is expressed in E. coli, which provides a cost-effective and efficient system for large-scale production .

  • Purity and Storage: The recombinant nem1 is purified to a high degree, typically greater than 90% as determined by SDS-PAGE. It is stored as a lyophilized powder at -20°C or -80°C to maintain stability .

Biological Function of nem1

In Schizosaccharomyces pombe, the nuclear envelope remains intact throughout the cell cycle, a process known as "closed" mitosis . The nem1 protein is involved in maintaining this integrity by regulating nuclear envelope morphology. Although specific mechanisms are not fully elucidated, proteins like nem1 are crucial for ensuring proper nuclear compartmentalization and function during cell division.

Research Applications

Recombinant nem1 is used in research to study nuclear envelope dynamics, particularly in the context of Schizosaccharomyces pombe. This includes investigations into how the nuclear envelope maintains its structure during mitosis and meiosis, and how proteins like nem1 contribute to these processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
nem1; SPBC3B8.10c; Nuclear envelope morphology protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-476
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
nem1
Target Protein Sequence
MNSIARLSDEINKAILATPLDDDEADKEKLANARGRASSATLRHYNRRRSSYSASSLSSL SSKPTEKEVPTRNEKPKHANIMRVVVYWIRVFLKRIYTFFVHSARVFLYHFLNEEKEFTL ASFFWGLCRFVFFPVLLSYKRREMLPPQPSVRRPRFYSSYSYPSSHQDPAYSSFKRHRSS NSYSSSSNGNHVRFQPSIAEEEISFNSFSNSLNSEEDVCVSPMKPKEVSLMGKANSNRSG HSHQPQSTQFSPPANDNISKLPSSFTIVNDPLKSPSSSRLRIRNITLCADKIPRPLLNSK LPRKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGEHPILYYIHKRPHLDYFLSNVSQW FRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDISICNIHLSRIMI IDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFLHALQYVHDVRDLLGLRLAK
Uniprot No.

Target Background

Function
A catalytic component of the Nem1-Spo7 complex, functioning as a phosphatase potentially crucial for maintaining proper nuclear membrane morphology.
Database Links
Protein Families
Dullard family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.