Recombinant Schizosaccharomyces pombe Nuclear envelope protein ndc1 (cut11)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitosis and Nuclear Organization

Cut11 is indispensable for mitotic fidelity and nuclear envelope integrity:

  • SPB Docking and Mitotic Spindle Formation:

    • Temperature-sensitive cut11 mutants exhibit defective bipolar spindle formation due to improper SPB duplication or mislocalization .

    • Cut11 ensures SPB insertion into the NE, enabling spindle microtubule nucleation .

  • NPC Assembly and Membrane Curvature Regulation:

    • Physically interacts with structural nucleoporins (e.g., Pom34, Nup53) and ER membrane-shaping proteins (e.g., Rtn1) .

    • Its amphipathic helix binds highly curved liposomes, facilitating NPC assembly at fusion sites between inner and outer nuclear membranes .

  • Genetic Interactions:

    • Deletion of Pom34 or Nup53 rescues cut11-ts mutant viability, suggesting competitive binding at the NE .

    • Synthetic lethality studies highlight functional redundancy with Nup59 and Pom152 .

Production and Purification of Recombinant Cut11

Recombinant Cut11 is synthesized using heterologous expression systems, with commercial and research-grade variants available:

Research Applications and Key Findings

Recombinant Cut11 has been instrumental in elucidating NE dynamics:

  • SPB-NE Interaction Mapping:

    • GFP-tagged Cut11 revealed punctate NE staining and transient SPB association during mitosis .

    • MYTH (Membrane Yeast Two-Hybrid) screens identified interactions with Pom34, Nup53, and Rtn1, underscoring its role in NPC assembly .

  • Membrane Curvature Studies:

    • Overexpression of Cut11’s amphipathic helix disrupts intracellular membranes, highlighting its role in curvature sensing .

    • Functional redundancy with Nup53’s amphipathic motif was demonstrated via suppression of ndc1Δ lethality in nup53Δ mutants .

  • Structural Insights:

    • Cryo-EM and serial sectioning revealed defective SPB duplication in cut11-ts mutants, linking its absence to free-floating SPBs in the nucleoplasm .

Future Directions

Ongoing research aims to:

  • Decipher the structural basis of Cut11’s interaction with the Y-complex nucleoporins (Nup120/Nup133) .

  • Explore its role in NPC biogenesis across eukaryotes, given conserved motifs in vertebrates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cut11; ndc1; SPAC1786.03; SPAC24C9.01; Nuclear envelope protein ndc1; Cell untimely torn protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cut11
Target Protein Sequence
MVMLRTSFPSGSRTKAVRYHTLLRPILQQRFLRACFALLCLCCITSYWFSSGPFISLSFW FLSLVRGFVCFFFMFPYFVMLKSRMSTQKVTKQSLGAQLFYDFSPKSFFLVYLTFAVSVS CLCLFYIKGHASSIRLQWIASPNAYELPSLNERFVYMTYFSHILILALTVEHLYLQRDSP SRPVINVSFFNYIFQNLGWLIRFSFRKSIICCLFTPFSYAILRSYIWRFAALLTSCCRRI AYTKTPPKWPLSLRLLLHSFWMAFIVCLTFQIALLIFRVFLYSGPMIRGKLLSARSNDPN GTLVDGMKTKKKPLTECIATEELWFIAKRDPQRIKSIFQDIDRSVSIWQELYSITESRCK ELATSLKILQSTGDFSAATSKKSGLTKKTNIPYSPNSNHEEINSIPLRNKNIFVPPSQGH SPLLEKIKKQGSLPSTTPVNEGGISDIIPKSLYDQVIRFISTFYKAPVFGIFRKTLRRQN EALLPNPWLFCVTVNSLTQLVLKSLKYDTYGVVARDISSILAVYCDTFDVLVSYKRSLVK NHSNSTNLDDDFKNLNSAANALHCGIIDITEKFQDFFTQLNLSPRIERRCWVLFREYKSN S
Uniprot No.

Target Background

Function
Nuclear envelope protein ndc1 (cut11) is a component of the nuclear pore complex (NPC) and the spindle pole body (SPB), playing a crucial role in the de novo assembly and insertion of both structures into the nuclear envelope. It is involved in the formation of the bipolar mitotic spindle and anchors the spindle pole body within the nuclear envelope.
Database Links
Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Note=Central core structure of the nuclear pore complex.

Q&A

What is Cut11/Ndc1 and what are its primary functions in S. pombe?

Cut11 is the Schizosaccharomyces pombe ortholog of the conserved integral membrane protein Ndc1. It serves dual critical functions within the nuclear envelope: tethering nuclear pore complexes (NPCs) and participating in spindle pole body (SPB) insertion during mitosis . As a component of the SPB, Cut11 is involved in SPB insertion into the nuclear envelope, which is essential for the formation of a functional bipolar spindle . Immunolocalization and fluorescent protein tagging studies show Cut11 displays punctate nuclear envelope staining throughout the cell cycle, with concentrated localization at SPBs from early prophase to mid-anaphase . This temporal SPB association directly correlates with the period when SPBs are inserted into the nuclear envelope to establish connections with nuclear microtubules .

How is the cut11+ gene organized in the S. pombe genome?

The cut11+ gene is located on the left arm of chromosome I in S. pombe, specifically in the NotI fragment F region . Gene mapping was performed using standard high-stringency hybridization techniques, where Cut11+ sequence was used to probe cosmid libraries . Sequence analysis reveals that cut11+ contains a single open reading frame (ORF) with no introns, followed by a polyadenylation site 33 base pairs downstream from the termination codon . The gene has been completely sequenced, with part of the cut11+ ORF (bases 912-1803) included in the S. pombe genome project (cosmid c24C9; accession number Z98601) . This genomic organization information is vital for researchers planning genetic manipulation experiments or gene expression studies.

What phenotypes are associated with cut11 mutations in S. pombe?

Temperature-sensitive (ts) alleles of cut11 display characteristic "cut" phenotypes, where cells attempt cytokinesis despite incomplete nuclear division . Detailed cytological analysis using fluorescent probes for tubulin and DNA reveals defective spindle structures in cut11-ts mutants . Three-dimensional reconstruction through serial sectioning and electron microscopy demonstrates that SPBs in these mutants either fail to complete normal duplication or appear as free-floating structures in the nucleoplasm . Genetic analysis shows that mutations L521F (cut11.1), C525R (cut11.2/3/4), and T498I (cut11.5/6) cause temperature sensitivity that can be rescued by deletion of either Pom34 or Pom152, suggesting that these nuclear pore components influence Cut11 function . These phenotypic profiles provide essential diagnostic tools for identifying defects in Cut11 function and for screening genetic or chemical suppressors.

What methods are effective for studying protein interactions involving Cut11/Ndc1?

The membrane yeast two-hybrid (MYTH) system has proven highly effective for studying Cut11 protein interactions . This split-ubiquitin-based approach allows for the detection of membrane protein interactions where traditional yeast two-hybrid systems may fail. To implement MYTH for Cut11 studies:

  • Generate a bait construct by fusing Cut11 to a C-terminal fragment of ubiquitin (Cub) and a transcription factor moiety containing both the E. coli LexA DNA-binding domain and the herpes simplex virus VP16 activation domain .

  • Screen against an arrayed library of integral and peripheral membrane proteins from S. pombe fused to the N-terminal fragment of ubiquitin (Nub) .

  • When bait and prey proteins interact, the Nub and Cub fragments reconstitute ubiquitin, resulting in transcription factor release and reporter gene activation .

This approach has successfully identified numerous Cut11 interacting proteins, including 75% of prey orthologous to proteins reported to physically interact with Ndc1 in S. cerevisiae . The high-throughput nature of this method allows examination of thousands of pairwise interactions in approximately two weeks .

How can recombinant Cut11/Ndc1 be produced in S. pombe expression systems?

Production of recombinant Cut11 in S. pombe requires careful consideration of expression systems and integration methods:

  • Vector Selection: Use integration vectors like pYIplac128 that can be linearized and integrated into the S. pombe genome for stable expression . This approach overcomes the instability issues often associated with plasmid-based expression .

  • Transformation Method: Transform linearized plasmids containing the cut11+ gene into appropriate S. pombe strains (such as Q01) using standard lithium acetate or electroporation methods .

  • Selection Strategy: Select transformants using auxotrophic markers (such as LEU2 for pYIplac128) by growing cells on selective media lacking specific amino acids .

  • Expression Verification: Confirm integration and expression using:

    • Southern blot analysis to verify integration at the correct genomic locus

    • Western blotting to detect protein expression

    • Fluorescence microscopy if using tagged constructs like Cut11-GFP

  • Cultivation Conditions: Maintain transformants in either leucine-deficient medium (0.67% Yeast nitrogen base without amino acids, 0.05% ammonium sulfate, 2% glucose, and appropriate amino acid supplements) or EMM thiamine agar plates .

This integrated approach ensures stable expression throughout cultivation, which is critical when studying essential genes like cut11+.

What imaging techniques are most appropriate for visualizing Cut11/Ndc1 localization?

Multiple complementary imaging approaches are recommended for comprehensive visualization of Cut11 localization:

  • Fluorescence Microscopy: Using Cut11 tagged with GFP allows visualization of its dynamic localization throughout the cell cycle . This approach reveals the punctate pattern at the nuclear envelope and its concentration at SPBs during specific mitotic phases .

  • Structured Illumination Microscopy (SIM): This super-resolution technique enables more detailed analysis of nuclear pore complex distribution relative to Cut11 localization . SIM has been successfully employed to study NPC organization in intact S. pombe nuclei, revealing NPC exclusion zones around the SPB .

  • Immunoelectron Microscopy: For ultra-structural localization, immunogold labeling of Cut11 followed by electron microscopy confirms its presence at nuclear pore complexes and SPBs at nanometer resolution .

  • 3D Reconstruction: Serial sectioning combined with electron microscopy allows three-dimensional reconstruction of nuclear structures, enabling visualization of how Cut11 mutations affect SPB duplication and nuclear envelope insertion .

When selecting imaging approaches, consider that fixation methods can impact nuclear envelope protein detection. Optimal results are often achieved with a combination of live-cell imaging for dynamic studies and fixed-cell approaches for high-resolution analysis.

How does the interaction network of Cut11/Ndc1 change in temperature-sensitive mutants?

Temperature-sensitive (ts) mutations in cut11 significantly alter its protein interaction network. Analysis using the MYTH system revealed that the canonical cut11-ts mutations (L521F, C525R, and T498I) disrupt specific protein interactions critical for Cut11 function . The altered interaction profiles provide important mechanistic insights:

  • The ts mutations affect Cut11's ability to interact with structural nucleoporins (particularly Nup53 homologs) and membrane-bending proteins that are essential for NPC assembly .

  • Notably, deletion of either Pom34 or Pom152 rescues the growth defects in all three causative mutations identified in cut11-ts strains . This suggests a competitive binding mechanism similar to that observed in S. cerevisiae, where Poms compete with the SUN-domain protein Mps3 for binding to Ndc1 .

  • The interaction data indicates that Cut11 function is regulated through a balance of protein-protein interactions that determine its localization between NPCs and SPBs .

These findings suggest that Cut11's function is spatially regulated through differential protein interactions, with ts mutations disturbing this balance. This understanding provides a foundation for rational design of mutations to specifically disrupt selected interactions for functional studies.

What is the relationship between NPC distribution and Cut11/Ndc1 function at the SPB?

A complex interplay exists between nuclear pore complex (NPC) distribution and Cut11's function at spindle pole bodies. Quantitative analysis using structured illumination microscopy has revealed:

  • Nuclear pore complex density is maintained across a wide range of nuclear sizes in S. pombe .

  • Specific regions of reduced NPC density are observed surrounding the spindle pole body (SPB) . This NPC exclusion zone appears to be functionally important.

  • The Lem2-mediated tethering of centromeres to the SPB is required to maintain this NPC exclusion zone . Importantly, this arrangement has been found to be necessary for timely mitotic progression .

  • Cut11/Ndc1 plays a dual role at both structures, potentially acting as a regulatory factor that coordinates SPB insertion with local NPC organization .

These observations suggest that Cut11/Ndc1 participates in a regulatory network that establishes specialized nuclear envelope domains with distinct protein compositions. The spatial segregation of NPCs from SPBs may be crucial for preventing functional interference between these structures during critical cell cycle events, particularly mitotic spindle formation.

How do post-translational modifications regulate Cut11/Ndc1 function?

While the search results do not directly address post-translational modifications (PTMs) of Cut11, research in related systems suggests several regulatory mechanisms that likely apply to Cut11 function:

  • Phosphorylation: Cell cycle-dependent phosphorylation likely regulates Cut11's association with different protein complexes. The dynamic localization of Cut11 to SPBs specifically during prophase through anaphase suggests that phosphorylation by cell cycle-regulated kinases may control this temporal association.

  • Ubiquitination: Given Cut11's role in both stable (NPCs) and dynamic (SPBs) nuclear envelope structures, ubiquitination may regulate protein stability or turnover rates at different cellular locations.

  • Membrane Environment: As an integral membrane protein, Cut11 function is likely influenced by lipid composition and membrane curvature. Interactions with membrane-bending proteins like Rtn1 and Yop1 homologs suggest that membrane-remodeling activities coordinate with Cut11 function.

To effectively study these PTMs, researchers should consider:

  • Phospho-specific antibodies for immunoprecipitation studies

  • Mass spectrometry approaches to identify modification sites

  • Mutagenesis of potential modification sites to assess functional consequences

  • Cell cycle synchronization methods to capture cycle-dependent modifications

Understanding these regulatory mechanisms will provide crucial insights into how Cut11 function is coordinated with cell cycle progression.

What strategies can address difficulties in detecting Cut11/Ndc1 protein-protein interactions?

Researchers frequently encounter challenges when studying Cut11 interactions due to its integral membrane nature. Several strategies can overcome these limitations:

  • Optimize Membrane Solubilization: Test different detergents (such as digitonin, DDM, or CHAPS) at varying concentrations to efficiently extract Cut11 while preserving its interactions. Each interaction may require different solubilization conditions.

  • Apply Complementary Approaches:

    • Use split-ubiquitin MYTH system specifically designed for membrane proteins

    • Combine with proximity labeling approaches (BioID or APEX) to capture transient interactions

    • Validate key interactions through co-immunoprecipitation with optimized solubilization

  • Consider Protein Domains: When full-length Cut11 proves challenging, express isolated domains that may mediate specific interactions, particularly the nucleoplasmic and luminal domains.

  • Control for Specificity: Include proper controls to distinguish genuine interactions from non-specific membrane protein associations:

    • Test interactions with unrelated membrane proteins

    • Use cut11-ts mutants as comparative interactomes

    • Employ truncated constructs to map interaction domains

  • Improve Detection Sensitivity: When working with native expression levels, enhance detection through:

    • Tandem affinity purification tags

    • More sensitive mass spectrometry methods

    • Concentration of membrane fractions before analysis

The MYTH system has proven particularly successful, identifying 75% of expected orthologs known to interact with Ndc1 in budding yeast, demonstrating its effectiveness for studying Cut11 interactions .

How can researchers analyze the functional consequences of Cut11/Ndc1 mutations?

A comprehensive approach to analyze Cut11 mutations should include:

  • Phenotypic Characterization:

    • Assess growth at various temperatures (25°C, 30°C, 36°C)

    • Analyze nuclear morphology and "cut" phenotypes using DAPI staining

    • Quantify mitotic progression defects using live-cell imaging

    • Measure frequency of chromosome segregation errors

  • Protein Localization Analysis:

    • Determine if mutations affect Cut11 localization to NPCs and/or SPBs

    • Quantify relative distribution between these structures using fluorescence intensity measurements

    • Perform time-lapse imaging to assess dynamics during cell cycle progression

  • Interactome Analysis:

    • Use MYTH screening to systematically compare interactomes of wild-type and mutant proteins

    • Focus on interactions with nuclear pore complex components (Pom34, Nup53 homologs) and SPB proteins

    • Analyze how mutations in specific domains affect different subsets of interactions

  • Genetic Interaction Mapping:

    • Test for synthetic lethality/sickness with mutations in genes encoding:

      • Other nuclear envelope proteins (especially Lem2)

      • NPC components (particularly Poms)

      • SPB components

    • Test for suppression of cut11-ts phenotypes through gene deletion (e.g., Pom34, Pom152)

  • Structural Analysis:

    • Map mutations onto predicted structural models to understand molecular mechanisms

    • Use electron microscopy to visualize effects on NPC and SPB ultrastructure

This multifaceted approach provides comprehensive insights into how specific mutations impact Cut11 function at both molecular and cellular levels.

What controls are essential when analyzing recombinant Cut11/Ndc1 expression?

When working with recombinant Cut11, the following controls are essential for reliable data interpretation:

  • Expression Level Verification:

    • Compare expression levels to endogenous Cut11 using quantitative western blotting

    • Ensure expression levels are physiologically relevant, as overexpression can cause artifacts

    • Use inducible promoters (like nmt1) with different strengths to titrate expression levels

  • Functionality Assessment:

    • Complement cut11-ts or cut11 deletion with recombinant constructs

    • Verify rescue of temperature-sensitive growth and "cut" phenotypes

    • Assess proper localization to both NPCs and SPBs through the cell cycle

  • Tag Interference Controls:

    • Compare N- and C-terminally tagged versions to identify potential tag interference

    • Use small epitope tags (FLAG, HA) as alternatives to larger tags (GFP)

    • Include untagged controls in parallel experiments

  • Strain Background Considerations:

    • Use consistent genetic backgrounds for all experiments

    • Account for potential genetic interactions in different strain backgrounds

    • Include wild-type controls from the same background

  • Genomic Integration Verification:

    • Confirm single-copy integration at the correct locus using Southern blotting

    • Verify absence of additional integrations that might affect expression

    • Sequence integration junctions to ensure no mutations were introduced

These controls ensure that phenotypes observed with recombinant Cut11 reflect its true biological function rather than artifacts of the expression system or genetic manipulation.

What are promising approaches for studying the role of Cut11/Ndc1 in nuclear envelope remodeling?

Several advanced approaches show promise for elucidating Cut11's role in nuclear envelope remodeling:

  • Real-time Membrane Dynamics: Implement high-speed super-resolution microscopy combined with membrane-specific dyes to visualize nuclear envelope remodeling during SPB insertion in live cells. This approach can reveal how Cut11 coordinates membrane deformation during this process.

  • In vitro Reconstitution Systems: Develop minimal in vitro systems with purified components to reconstitute Cut11-mediated membrane remodeling events. Such systems would allow precise manipulation of membrane composition, curvature, and protein concentrations.

  • Cryo-electron Tomography: Apply cryo-ET to visualize the molecular architecture of Cut11 within NPCs and SPBs at near-atomic resolution, providing structural insights into its membrane-remodeling mechanisms.

  • Optogenetic Tools: Develop optogenetic approaches to spatiotemporally control Cut11 function in living cells, enabling precise manipulation of its activity during specific cell cycle stages.

  • Quantitative Biophysical Measurements: Implement biophysical approaches to measure membrane curvature, tension, and fluidity changes associated with Cut11 function at both NPCs and SPBs.

These multidisciplinary approaches will provide mechanistic insights into how Cut11 facilitates the remarkable remodeling events that occur during NPC assembly and SPB insertion into an intact nuclear envelope.

How might advanced genomic engineering approaches advance Cut11/Ndc1 research?

Modern genomic engineering technologies offer powerful approaches for Cut11 functional studies:

  • CRISPR-Cas9 Base Editing: Apply precise base editing to introduce specific point mutations without double-strand breaks, enabling the creation of allelic series to dissect domain functions.

  • Auxin-inducible Degron (AID) System: Implement rapid protein depletion systems to study acute loss of Cut11 function at specific cell cycle stages, circumventing the challenges of studying an essential gene.

  • Split Protein Complementation: Develop split Cut11 systems where functional complementation depends on specific protein interactions, allowing visualization and manipulation of selected Cut11 complexes.

  • Domain Swapping: Create chimeric proteins between Cut11 and related proteins from other species to map functionally conserved and divergent regions.

  • Systematic Mutagenesis: Implement deep mutational scanning approaches to comprehensively map the functional landscape of Cut11, identifying critical residues for specific functions and interactions.

These advanced genomic approaches will enable unprecedented precision in manipulating Cut11 function and provide powerful new tools for understanding its dual roles at NPCs and SPBs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.