Recombinant Schizosaccharomyces pombe Nuclear membrane organization protein apq12 (apq12)

What is the basic structure of the Apq12 protein in S. pombe?

Apq12 is a 115-amino acid nuclear membrane organization protein with two transmembrane domains (TM1 and TM2) connected by an amphipathic α-helix (AαH) . The complete amino acid sequence is: MSLTSVLWNFVAKLAVDHGLNTNPDQVFQTVENVGKSFEKYETSFLKSLFNGNLGLSLPSAINILTLIIVLYFSLVIVNKTTSIALALFKTLAVISFFLLIGCLFAYWFINNGSF . This small protein has a UniProt ID of O94353 and is characterized by its specific membrane topology that plays a critical role in nuclear envelope organization .

What is the subcellular localization and topology of Apq12?

Experimental evidence using split GFP systems demonstrates that both the N- and C-termini of Apq12 are oriented toward either the cytoplasm or nucleoplasm depending on whether Apq12 is located at the outer nuclear membrane (ONM)/endoplasmic reticulum (ER) or inner nuclear membrane (INM), respectively . This topology has been confirmed by combining GFP1-10 tagged versions of Apq12 with nuclear and cytoplasmic GFP11 localized proteins, revealing a green fluorescent nuclear envelope signal . The amphipathic α-helix of Apq12 resides in the perinuclear space connecting the two transmembrane regions .

What is the functional significance of the amphipathic α-helix in Apq12?

The amphipathic α-helix (AαH) in Apq12 plays a crucial role in nuclear pore complex (NPC) biogenesis by promoting phosphatidic acid (PA) accumulation at the nuclear envelope . Mutations disrupting the amphipathic nature of this helix (apq12-ah) cause severe growth defects at lower temperatures (similar to apq12Δ), demonstrating that the amphipathic properties of this helix are essential for proper protein function . Research shows that cells with apq12-ah completely fail to grow at 16°C and show reduced growth at 23°C, phenocopying the apq12Δ mutant .

What expression systems are optimal for recombinant Apq12 production?

For recombinant production of full-length S. pombe Apq12 protein, E. coli expression systems with N-terminal His tags have proven successful . The methodology involves:

• Gene cloning into an appropriate expression vector with a His-tag

• Expression in E. coli under optimized conditions

• Purification to >90% purity as determined by SDS-PAGE

• Lyophilization for storage stability

For experimental applications, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

How can researchers determine the membrane topology of Apq12?

The membrane topology of Apq12 can be effectively determined using the split GFP system, which allows assessment of protein orientation within cellular membranes . The methodology involves:

• Creating fusion constructs of Apq12 with GFP1-10 (either N- or C-terminal fusions)

• Co-expressing these constructs with GFP11-tagged proteins of known localization (e.g., GFP11-mCherry-Scs2TM for ONM/ER localization or GFP11-mCherry-Pus1 for nuclear localization)

• Observing reconstituted GFP fluorescence by microscopy

• Comparing results with control proteins of known topology (e.g., Mps3-GFP1-10)

This technique has revealed that both the N- and C-termini of Apq12 are exposed to either the cytoplasm or nucleoplasm depending on whether the protein resides in the ONM/ER or INM .

What methods are most effective for studying Apq12 function in NPC biogenesis?

To study Apq12's role in nuclear pore complex (NPC) biogenesis, researchers employ several complementary techniques:

• Mutational analysis: Creating targeted mutations in the amphipathic α-helix (e.g., apq12-ah) to assess functional consequences

• Controlled expression systems: Using galactose-inducible promoters (PGal1) to regulate Apq12 expression levels

• Electron microscopy (EM): Examining nuclear envelope morphology changes in response to Apq12 manipulation

• Immuno-EM: Localizing Apq12 at specific nuclear envelope structures, particularly at NPC biogenesis intermediates and bent INM segments

• Live-cell fluorescence microscopy: Tracking the distribution of NPC components and biogenesis factors (e.g., Brl1, Brr6) in response to Apq12 modulation

These approaches have revealed that Apq12 associates with NPC biogenesis intermediates at bent INM segments, and this localization does not require a functional AαH .

What proteins interact with Apq12 and how do these interactions influence nuclear envelope organization?

Apq12 exhibits important physical and genetic interactions with several proteins, particularly Brl1 and Brr6, which together form a functional module involved in nuclear envelope organization and NPC biogenesis . The interaction network includes:

Analysis of protein levels indicates an increase of Brl1 protein in apq12Δ and apq12-ah mutants compared to wild-type, with a more pronounced increase in apq12Δ mutants . Similarly, Brr6-yeGFP levels are elevated in apq12-ah mutants compared to wild-type . These findings suggest that Apq12, particularly through its amphipathic α-helix, regulates the abundance and interaction between Brl1 and Brr6 .

How does overexpression of Apq12 affect cellular processes and associated proteins?

Overexpression of APQ12 using the galactose-inducible PGal1 promoter has significant effects on cellular processes:

• Toxicity: Unlike its partner proteins BRL1 and BRR6, overexpression of APQ12 is toxic to cells

• Mislocalization of NPC biogenesis factors: One hour of PGal1-induced Apq12 overexpression leads to dense clustering of Brl1 and Brr6 on the nuclear envelope, which are devoid of the NPC marker Nup85-tdTomato

• Membrane proliferation: Induces extension of ER tubes from the ONM, which can fuse with the NE and entrap cytoplasmic content into ONM-encircled compartments

• Ultrastructural changes: EM analysis shows that APQ12 overexpression leads to a shift in the number of NE extensions from 5% to 40%, with some connecting to the cortical ER

These findings demonstrate that Apq12 levels must be tightly regulated for proper nuclear envelope organization and function.

What are the phenotypic consequences of Apq12 mutations, particularly in the amphipathic α-helix?

Mutations affecting Apq12, especially those disrupting the amphipathic α-helix, result in distinct phenotypes:

The apq12-ah mutant shows that the amphipathic nature of the AαH in Apq12 is critical for cell growth at lower temperatures . Importantly, while the distribution of the mutant protein remains unaffected and it assumes the correct topology within the membrane, these mutations still lead to NPC biogenesis defects and disrupted nuclear envelope integrity .

How does the helical hydrophobic moment of the amphipathic α-helix correlate with Apq12 function?

Research has revealed a direct correlation between the helical hydrophobic moment of Apq12's amphipathic α-helix and protein functionality:

• Wild-type Apq12 has an optimal helical hydrophobic moment that supports proper function

• The apq12F5DI6RV9N mutant has a decreased helical hydrophobic moment of 0.222, representing an intermediate value between the wild-type AαH and the more severely disrupted apq12-ah

• The apq12-ah mutant has a substantially reduced helical hydrophobic moment, causing complete growth failure at 16°C

This structure-function relationship demonstrates that the precise amphipathic properties of the α-helix are critical for Apq12's role in nuclear envelope organization, with even partial reductions in the helical hydrophobic moment resulting in measurable functional deficits .

How does Apq12 contribute to phosphatidic acid accumulation at the nuclear envelope?

Apq12's amphipathic α-helix (AαH) plays a crucial role in promoting phosphatidic acid (PA) accumulation at the nuclear envelope during NPC biogenesis . The mechanism involves:

• The amphipathic α-helix likely induces local PA accumulation at the nuclear envelope

• Overexpression of APQ12 triggers PA accumulation at the NE in a manner dependent on a functional AαH

• This PA enrichment is believed to create localized membrane environments favorable for NPC assembly

• In apq12-ah mutants, this PA accumulation is impaired, contributing to NPC biogenesis defects

The short amphipathic α-helix of Apq12 regulates the function of Brl1 and Brr6 and promotes PA accumulation at the NE during NPC biogenesis, establishing a mechanistic link between membrane composition and nuclear pore formation .

What experimental approaches can resolve contradictory data regarding Apq12's role in membrane fusion events?

When researchers encounter contradictory data regarding Apq12's role in membrane fusion events, several advanced experimental approaches can help resolve these discrepancies:

• Correlated light and electron microscopy (CLEM): Combining fluorescence microscopy with EM to directly correlate Apq12 localization with membrane fusion events

• Super-resolution microscopy: Using techniques like PALM, STORM, or expansion microscopy to visualize Apq12 distribution at fusion sites with nanometer precision

• In vitro reconstitution assays: Purifying recombinant Apq12 and testing its ability to induce membrane curvature or fusion using synthetic liposomes

• Targeted mutations with structure-guided design: Creating specific point mutations based on structural predictions to disrupt particular functions while preserving others

• Lipidomics analysis: Quantitatively assessing changes in membrane lipid composition, particularly PA levels, in response to Apq12 manipulation

These approaches have revealed that Apq12 associates with NPC biogenesis intermediates at bent INM segments, suggesting a role in membrane remodeling that precedes fusion events during NPC assembly .

How can researchers differentiate between direct and indirect effects of Apq12 manipulation?

To distinguish between direct and indirect effects of Apq12 manipulation, researchers can employ several strategic approaches:

• Acute protein inactivation: Using techniques like auxin-inducible degron (AID) or rapamycin-inducible dimerization to rapidly deplete or relocalize Apq12

• Structure-function analysis: Creating targeted mutations that selectively disrupt specific interaction surfaces or functional domains

• Proximity labeling: Employing TurboID, APEX, or BioID fused to Apq12 to identify proteins in direct proximity

• Synthetic genetic array (SGA) analysis: Systematically combining apq12 mutations with genome-wide mutant collections to identify genetic interactions

• Temporal analysis of cellular responses: Following the sequential molecular events after Apq12 perturbation to establish cause-effect relationships

Research has demonstrated that while apq12-ah mutations affect Brl1 and Brr6 protein levels and interactions, Apq12 localizes to NPC biogenesis intermediates independent of its AαH, suggesting separate functional domains for different aspects of Apq12 activity .

What are the optimal storage and handling conditions for recombinant Apq12 protein?

For successful experiments with recombinant Apq12 protein, proper storage and handling are critical:

Repeated freezing and thawing should be avoided, and it is recommended to briefly centrifuge vials prior to opening to bring contents to the bottom . Using these optimized conditions ensures maximum protein stability and experimental reproducibility.

What controls should be included when studying Apq12's role in nuclear pore complex assembly?

When investigating Apq12's role in nuclear pore complex assembly, several essential controls should be incorporated to ensure experimental validity:

• Genetic controls:

  • Wild-type APQ12 strain (positive control)

  • apq12Δ deletion strain (negative control)

  • Complementation with wild-type APQ12 in apq12Δ background

  • Temperature-sensitive strains grown at permissive temperatures

• Experimental approach controls:

  • Split GFP system: Include the perinuclear space protein Mps3-GFP1-10 that fails to reconstitute with cytoplasmic/nuclear GFP11 markers

  • Overexpression studies: Include non-toxic membrane proteins like BRL1 and BRR6 as specificity controls

  • Protein localization: Compare distribution of multiple NPC markers (e.g., Nup85-tdTomato) to distinguish general from specific effects

• Condition controls:

  • Temperature range testing (16°C, 23°C, 30°C, 37°C) to capture cold-sensitive phenotypes

  • Time-course experiments during induction of overexpression (0.5h, 1h, 3h)

  • Parallel analysis of membrane morphology by electron microscopy to correlate functional and structural changes

These comprehensive controls help distinguish specific Apq12-dependent effects from general perturbations of nuclear envelope organization.