Recombinant Schizosaccharomyces pombe Nucleus export protein brr6 (brr6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Nucleus Export Protein Brr6 (Brr6)

Recombinant Schizosaccharomyces pombe Nucleus Export Protein Brr6 (Brr6) is an integral membrane protein located in the nuclear envelope (NE) and is involved in nuclear pore complex (NPC) distribution and nuclear envelope morphology . It is essential for mRNA nuclear export and maintaining genome integrity during DNA replication and exposure to toxic compounds that stall or collapse replication forks .

Gene Information and Characteristics

FeatureDescription
Gene Namebrr6
Synonymsbrr6; brl1; SPAC8F11.06; Nucleus export protein brr6
UniProt IDQ9UT30
SpeciesSchizosaccharomyces pombe
SourceE. coli
TagHis
Protein LengthFull Length (1-297 amino acids)
AA SequenceMEMYVEDVPMPDIGPDSVLNTPIRPKYEILKSKKKTQNENDPEPMDISMSPDEKNLKKSTVRRKLRKSKPNSSSNQVSSRTRALTKRSNSSNAIIKANNQDSVYVSDWTNVHRDIPIVVSGYLQLMFNACVASIFLYFLFKIVFGIQNDVRNRVEYHKILQEEQAADCQREYLSINCDSPGPAIFEVCQKLKQCKMESSNNVGSTKLAALVFAEIIDAFISHISYKTMVFSLILVFGSLLTSNYAFGLYRARHSQNIHDYAANAIPAMIPSSRFLPSNLSDISNRNLIEAASQEEEI
Molecular WeightApproximately 34 kDa [Refer to UniProt ID: Q9UT30]
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Function and Role

  1. mRNA Export: Brr6 is required for mRNA nuclear export . The brr6-1 mutant shows a specific defect in the transport of mRNA and a protein reporter containing a nuclear export signal .

  2. NPC Biogenesis: Brr6 and its paralog Brl1 are involved in NPC biogenesis. Depletion of both Brr6 and Brl1 causes defects in NPC biogenesis, but pre-assembled NPCs remain unaffected . Brr6 and Brl1 associate with a subpopulation of NPCs and emerging NPC assembly sites .

  3. Nuclear Envelope Morphology: Brr6 affects nucleoporin distribution and nuclear envelope morphology, suggesting it is needed for the spatial organization of nuclear pores .

  4. Spindle Pole Body Dynamics: Brr6 is required for the insertion and release of the cytoplasmic domain of the Schizosaccharomyces pombe spindle pole body from a nuclear envelope fenestra during mitosis .

  5. Genome Integrity: Brr6 contributes to genome integrity during normal DNA replication and when cells are exposed to toxic compounds that stall or collapse replication forks .

Interactions and Localization

  1. Subcellular Localization: Brr6 behaves like a nuclear envelope integral membrane protein and localizes to a punctate nuclear rim pattern, suggesting a location at or near the nuclear pore .

  2. Protein Interactions: Brl1 interacts with Ndc1 and Nup188, transmembrane, and outer and inner ring NPC components, indicating a direct role in NPC biogenesis . Brr6 and Brl1 interact with each other .

  3. Genetic Interactions: BRR6 interacts genetically with a subset of nucleoporins . It also displays synthetic lethality and dosage suppression with apq12Δ, indicating a functional link between these proteins .

Brr6 and Brl1: Paralogous Proteins

Brr6 and Brl1 are paralogous proteins with conserved roles in NPC biogenesis . They have two transmembrane domains with N and C termini exposed to the nucleoplasm or cytoplasm . Brr6 and Brl1 form intramolecular disulfide bonds, likely within the intermembrane space of the NE, which is important for the protein's stability and function .

Role in Lipid Metabolism

Brr6 and Apq12 are linked to the assembly of the endoplasmic reticulum (ER) exit sites and lipid homeostasis . Overexpression of BRR6 restores normal levels of episterol in apq12Δ cells, suggesting a role in modulating or sensing lipid levels or membrane properties .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
brr6; brl1; SPAC8F11.06; Nucleus export protein brr6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
brr6
Target Protein Sequence
MEMYVEDVPMPDIGPDSVLNTPIRPKYEILKSKKKTQNENDPEPMDISMSPDEKNLKKST VRRKLRKSKPNSSSNQVSSRTRALTKRSNSSNAIIKANNQDSVYVSDWTNVHRDIPIVVS GYLQLMFNACVASIFLYFLFKIVFGIQNDVRNRVEYHKILQEEQAADCQREYLSINCDSP GPAIFEVCQKLKQCKMESSNNVGSTKLAALVFAEIIDAFISHISYKTMVFSLILVFGSLL TSNYAFGLYRARHSQNIHDYAANAIPAMIPSSRFLPSNLSDISNRNLIEAASQEEEI
Uniprot No.

Target Background

Function
This protein is involved in mRNA and protein export from the nucleus.
Gene References Into Functions
  1. Brr6 drives the Schizosaccharomyces pombe spindle pole body nuclear envelope insertion/extrusion cycle. PMID: 22042620
Database Links
Protein Families
BRL1/BRR6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Brr6 and what are its core structural features?

Brr6 (UniProt accession: Q9UT30) is a nucleus export protein in Schizosaccharomyces pombe encoded by the brr6 gene (also known as brl1, SPAC8F11.06). It is an essential nuclear envelope integral membrane protein with a predicted size of 22.8 kDa . The protein contains multiple phosphorylation sites, particularly on serine residues (S48, S50, S88, S90, S91, and S292) as identified through proteomic analyses . Brr6 shares approximately 44% sequence similarity with its paralogue Brl1 in their structured regions . Similar to Brl1, Brr6 contains a predicted luminal amphipathic helix (AH) that likely plays a role in membrane binding and curvature sensing .

How does Brr6 localize within the cell?

Brr6 exhibits a punctate nuclear rim pattern in live cell imaging, suggesting localization at or near nuclear pores . Unlike many nucleoporins, Brr6-GFP fails to redistribute in a Δnup133 mutant, distinguishing it from known proteins of the pore membrane domain . While its paralogue Brl1 primarily localizes to the inner nuclear membrane (INM), Brr6 can be found in both nuclear envelope leaflets . During mitosis, Brr6 is transiently recruited to spindle pole bodies (SPBs) specifically during SPB insertion into and extrusion from the nuclear envelope, indicating a dynamic localization pattern associated with cell cycle progression .

What post-translational modifications regulate Brr6 function?

Brr6 undergoes extensive phosphorylation, primarily on serine residues. The following table summarizes the known phosphorylation sites in S. pombe Brr6:

SitePTM TypeEvidence ScoreSource DatabasesSupporting Publications
S48Phosphorylationscore1PomBase29996109, 25720772
S50Phosphorylationscore1PomBase21712547, 33823663, 29996109, 25720772
S88Phosphorylationscore1PomBase30726745
S90Phosphorylationscore2PomBase, UniProt18257517, 24763107, 33823663, 30726745, 21712547, 25720772
S91Phosphorylationscore1PomBase24763107, 30726745
S292Phosphorylationscore1PomBase33823663, 25720772

How does Brr6 contribute to nuclear transport?

Brr6 plays a critical role in nuclear transport, particularly in mRNA export and nuclear export signal (NES)-dependent protein transport. In S. cerevisiae, the brr6-1 cold-sensitive mutant exhibits constitutive nuclear mRNA export defects, with poly(A)+ RNA accumulating at the nuclear rim . Additionally, a nuclear export signal (NES) protein reporter shows pronounced accumulation at the nuclear rim in brr6-1 mutant cells, while nuclear import remains unaffected .

Interestingly, Brr6 appears to impact specific transport pathways rather than affecting all nucleocytoplasmic transport. For example:

  • NLS/NES-GFP reporter: Shows nuclear rim accumulation in brr6-1 mutants

  • NLS-GFP reporters (without NES): Distribution unaffected in brr6-1

  • RNA-binding proteins (Npl3p, Nab2p): Localization unchanged in brr6-1

  • Ribosomal protein reporters (L25-GFP): No defects observed

What is Brr6's role in nuclear pore complex assembly?

Though not a core nucleoporin, Brr6 appears to function in concert with nuclear pore complex (NPC) components to facilitate proper NPC assembly. The genetic interactions between BRR6 and various nucleoporins provide evidence for this role. Specifically:

  • brr6-1 is synthetically lethal with nup188cs/brr7-1

  • Overexpression of BRR6 dramatically impairs growth in Δnup188 and Δnup1 deletion strains

  • Synthetic lethality is observed between BRR6 and Δnup2, C-terminal Δnic96, xpo1-1, and gle2-1

Depletion of Brr6 alters nucleoporin distribution and nuclear envelope morphology, suggesting it is required for the spatial organization of nuclear pores . Unlike its paralogue Brl1, Brr6 cannot rescue certain NPC assembly mutants (gle2Δ, nup116Δ, nup116ΔGLFG PMET3-NUP188) through overexpression, indicating functionally distinct roles despite structural similarities .

How does Brr6 function in spindle pole body dynamics during mitosis?

In S. pombe, Brr6 plays a crucial role in spindle pole body (SPB) dynamics during mitosis. The SPB in fission yeast is a bipartite structure with cytoplasmic and nuclear components separated by the nuclear envelope during interphase . During mitotic entry, the SPB must be incorporated into a fenestra (opening) that forms within the nuclear envelope .

Brr6 is transiently recruited to SPBs specifically during:

  • SPB insertion into the nuclear envelope at mitotic entry

  • SPB extrusion from the nuclear envelope during anaphase B/mitotic exit

Mutation studies demonstrate that Brr6 is required for:

  • Proper SPB insertion into the nuclear envelope

  • Maintaining nuclear envelope integrity during anaphase B/mitotic exit

  • Spindle formation

The temperature-sensitive mutant brr6.ts8 shows severe defects in spindle formation, with cells initially forming monopolar spindles followed by a complete absence of microtubule structures in cells with condensed chromosomes . This indicates that Brr6 is essential for the complex membrane remodeling events that accommodate SPB dynamics throughout mitosis.

What techniques are used to visualize Brr6 localization and dynamics?

Several microscopy techniques have been employed to study Brr6 localization and dynamics:

  • Fluorescence microscopy with GFP fusion proteins: Brr6-GFP fusion constructs allow visualization of the protein's punctate distribution at the nuclear rim .

  • Fluorescence Recovery After Photobleaching (FRAP): Although not specifically applied to Brr6 in the provided studies, FRAP has been used to study the dynamics of related proteins using techniques such as:

    • Unidirectional scanner at speed of 1400 Hz

    • NF488/561/633

    • Aperture unit (AU) of 1.5

    • FRAP booster for bleaching

    • PMT3 (500–551 nm) and PMT5 (575–694 nm) detectors

    • Image sizes of 512 × 75 at 80 nm/pixel

    • Line accumulation of two (120 ms per frame)

    • 20 pre-bleach and 200 post-bleach frames

    • 488 nm argon laser line (20% base power) and 561 nm DPSS laser line

  • In situ hybridization: For assessing the impact of Brr6 mutations on mRNA export, using probes such as oligo(dT)50 to detect poly(A)+ RNA .

  • Live-cell imaging: To monitor the recruitment and dynamics of Brr6 at the SPB during different stages of mitosis .

How can Brr6 mutants be generated and characterized?

Several approaches have been used to generate and characterize Brr6 mutants:

  • Genetic screening:

    • Cold-sensitive mutants like brr6-1 were identified through complementation of growth defects

    • Temperature-sensitive mutants like brr6.ts8 have been generated for more stringent conditional studies

    • Screening for mutations that formed monopolar spindles upon exposure to 4% DMSO identified a glycine-to-aspartic acid change at position 145

  • Gene disruption and replacement:

    • BRR6 ORF can be disrupted with markers like HIS3

    • Integration of wild-type and mutant alleles into deletion strains to generate isogenic strains

  • Conditional expression systems:

    • Placing BRR6 under control of the repressible GAL1-GAL10 promoter allows for depletion studies

  • Phenotypic characterization:

    • Growth assays at permissive and restrictive temperatures

    • Fluorescence microscopy to assess protein localization and transport reporter distribution

    • In situ hybridization to detect mRNA export defects

    • Immunofluorescence to monitor spindle formation and chromosome condensation

What approaches can determine functional relationships between Brr6 and other proteins?

Several experimental approaches can elucidate functional relationships between Brr6 and other proteins:

  • Genetic interaction studies:

    • Testing synthetic lethality between brr6 mutants and mutations in other genes

    • Assessing growth phenotypes when BRR6 is overexpressed in strains with mutations in related genes

  • Protein localization studies:

    • Examining how mutations in Brr6 affect the localization of nucleoporins and other nuclear envelope proteins

    • Determining how nucleoporin mutations affect Brr6 localization

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to detect physical interactions

    • Proximity labeling approaches

    • Yeast two-hybrid screening

  • Functional complementation:

    • Testing whether overexpression of BRR6 can rescue defects in mutants of functionally related genes

    • Examining whether overexpression of other genes can rescue brr6 mutant phenotypes

What are the remaining questions about Brr6's mechanism of action?

Despite significant progress in understanding Brr6 function, several key questions remain:

  • How exactly does Brr6 facilitate nuclear membrane remodeling during NPC assembly and SPB dynamics?

  • What is the precise molecular mechanism by which Brr6 contributes to mRNA and protein export?

  • How do the phosphorylation events on Brr6 regulate its function during different cell cycle stages?

  • What is the three-dimensional structure of Brr6, and how does it interact with membranes?

  • How do Brr6 and its paralogue Brl1 coordinate their functions, given their partial redundancy?

Addressing these questions will require advanced structural biology approaches, high-resolution live cell imaging, and comprehensive protein interaction studies .

How does research on S. pombe Brr6 translate to understanding similar processes in other organisms?

S. pombe serves as an excellent model for studying nuclear envelope dynamics due to its closed mitosis, where the nuclear envelope remains intact throughout cell division. Research on S. pombe Brr6 has several implications for understanding related processes in other organisms:

  • Membrane remodeling mechanisms during nuclear envelope dynamics are conserved across species

  • Nuclear transport machinery components show evolutionary conservation

  • Principles of nuclear pore complex assembly likely apply to various eukaryotes

  • Mechanisms of spindle pole body/centrosome integration with the nuclear envelope during mitosis may have parallels in other systems

Comparative studies between S. pombe Brr6 and its homologs in other organisms could reveal conserved functional domains and mechanisms that are fundamental to nuclear envelope dynamics across eukaryotes .

What novel techniques might advance our understanding of Brr6 function?

Several emerging techniques could significantly advance our understanding of Brr6 function:

  • Cryo-electron tomography: To visualize the three-dimensional architecture of Brr6 in the context of the nuclear envelope and nuclear pore complexes

  • Single-molecule tracking: To monitor the real-time dynamics of individual Brr6 molecules during various cellular processes

  • Optogenetics: To achieve temporally precise control of Brr6 function in living cells

  • Proximity-dependent biotinylation (BioID or TurboID): To identify proteins that interact with Brr6 in specific cellular compartments or under specific conditions

  • High-resolution live-cell imaging techniques (such as lattice light-sheet microscopy): To visualize Brr6 dynamics during membrane remodeling events with improved spatial and temporal resolution

  • Mass spectrometry-based phosphoproteomics: To comprehensively identify phosphorylation sites on Brr6 and determine how they change during the cell cycle

What are the optimal expression systems for recombinant S. pombe Brr6?

For researchers working with recombinant S. pombe Brr6, several expression systems can be considered:

  • Homologous expression in S. pombe:

    • Advantages: Proper post-translational modifications, correct membrane insertion

    • Expression vectors: pREP series with thiamine-repressible promoters of varying strengths

    • Tags: GFP, mCherry, or epitope tags (HA, Myc) have been successfully used with Brr6

  • Heterologous expression systems:

    • E. coli: Challenging due to membrane protein nature, may require specialized strains

    • Insect cells: Better for membrane proteins but may lack some post-translational modifications

    • Mammalian cells: Good for functional studies but more expensive and lower yield

  • Cell-free expression systems:

    • Suitable for membrane proteins when supplemented with appropriate lipids

    • Allows rapid expression for structural and functional studies

The choice of expression system should be guided by the specific research questions and downstream applications. For structural studies, larger quantities of purified protein may be required, while functional studies might benefit from expression in a system that preserves native interactions and modifications.

What controls are essential when studying Brr6 mutant phenotypes?

When studying Brr6 mutant phenotypes, several controls are essential to ensure reliable interpretation of results:

  • Isogenic wild-type strains: Use of genetically identical strains differing only in the BRR6 gene to control for strain background effects

  • Temperature controls: For temperature-sensitive mutants, include controls at both permissive and restrictive temperatures

  • Rescue controls: Demonstrate that phenotypes can be rescued by expression of wild-type BRR6

  • Multiple mutant alleles: Using different mutant alleles (e.g., brr6-1, brr6.ts8) to confirm that phenotypes are specifically associated with Brr6 dysfunction rather than off-target effects

  • Marker controls: When using reporter constructs (like NLS-GFP or NLS/NES-GFP), include appropriate controls to distinguish between general transport defects and Brr6-specific effects

  • Time-course experiments: Monitor phenotypes over time after shifting to restrictive conditions to distinguish primary from secondary effects

  • Functional redundancy controls: Test the effects of manipulating related proteins (like Brl1) to account for potential compensatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.