Recombinant Schizosaccharomyces pombe Palmitoyltransferase akr1 (akr1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant S. pombe akr1 is typically expressed in heterologous systems (e.g., E. coli, yeast, or mammalian cells) and purified to ≥85% homogeneity via SDS-PAGE . Key attributes include:

AttributeDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE validated)
Gene Nameakr1
Protein LengthPartial sequence (exact length unspecified in available data)
Functional DomainsAnkyrin repeat-containing domain; DHHC-CRD (catalytic domain)

The enzyme’s partial recombinant form retains catalytic activity, enabling studies of substrate specificity and biochemical mechanisms.

Functional Roles in Meiosis

In S. pombe, native akr1 regulates meiotic progression through S-palmitoylation of critical proteins. Key findings from functional studies include:

Palmitoylation of Tht1 for Nuclear Fusion

akr1 S-palmitoylates the nuclear fusion protein Tht1 at cysteine residues 65 and 78 . This modification:

  • Stabilizes Tht1 and localizes it to the endoplasmic reticulum (ER).

  • Enables interaction with Sey1, an ER fusion GTPase, ensuring proper karyogamy.

Consequences of akr1 Deficiency:

  • Unfused nuclei and chromosome segregation defects during meiosis.

  • Aberrant spore formation due to mislocalized Tht1 .

Comparative Analysis with Other Palmitoyltransferases

PalmitoyltransferasePrimary SubstrateFunction
Erf2-Erf4Ras1 (Cys215)Mating pheromone response and cell polarization
Akr1Tht1 (Cys65/78), Isp3Nuclear fusion, spore coat assembly

Experimental Validation

  • Acyl-RAC Assays: Demonstrated Tht1 palmitoylation in wild-type (WT) cells but reduced recovery in akr1-deficient strains .

  • Mutagenesis: Tht1 mutants (C65A/C78A) failed to rescue meiotic defects, confirming palmitoylation’s necessity .

Research Applications

Recombinant akr1 is a valuable tool for:

  1. Enzymatic Assays: Studying substrate specificity and catalytic mechanisms in vitro.

  2. Structural Biology: Mapping palmitoylation sites and protein interactions.

  3. Therapeutic Development: Exploring targeting of palmitoylation in diseases linked to meiotic errors (e.g., infertility).

Limitations and Challenges

  • Partial Recombinant Form: Currently, full-length recombinant S. pombe akr1 is not commercially available, limiting structural studies .

  • Species-Specific Activity: Functional data primarily derive from native S. pombe studies; recombinant applications remain underexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please specify it in your order; we will prioritize its development.
Synonyms
akr1; SPAC2F7.10; Palmitoyltransferase akr1; Ankyrin repeat-containing protein akr1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-642
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
akr1
Target Protein Sequence
MGSLFLAASQGELDTVKNLISSEKIDVNATDEGGATALHWAALNQQIPICKFLLEHGADV NAIGGDLQAAPIHWAAKRGSVKTVHYLVQHGADPLLKDKQGFNCLHLAVHAASPLLVVYL LHLDISVDLRDDQQHTPLMWASYHGNEPITNCLLRWGADVLATDEDKMTPLHWSIVGGNL KCMKLILKEGGIPCTAVTANLSGQLKTPWALASELRVSHLFKQALISNGLKVKETSEEPE KWVVVPSKFQFSQKTFIIFCFLSSFIITGVFFFIMSICPMVISLIIAPLWIYFTFKYITT CIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSLLYIVPKTLPIKPLSSLLFVLISFTCI GLYVRTAFQNPGYVDKIGAVVQRREEISKLLDKDLFNQSHYCLKCFQVKPPRSYHCGACK RCINRYDHHCPWTGNCVGARNHRTFLLFVFTLSTLIPIYFYVAFYYLQNIPIQKKYESYR CLFISGTICQWSLKDMFVLVASLTLFVNWCWVVVLAFTQICQVAHNVTTAEFRLFKRYGT LVPPTKQNSSPKNGHGIHGSFLRTVCGILGLDQCILLIRESNCFVRCFPSRAELGSQNST SLSRNLSTVNPYDEGSIIKNCKTFWKQNFLNDGRQDEATRHV
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Palmitoyltransferase akr1 (akr1) is a palmitoyltransferase specific for casein kinase 1.

Database Links
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Early endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Palmitoyltransferase akr1?

Akr1 is a protein palmitoyltransferase in the fission yeast Schizosaccharomyces pombe that catalyzes S-palmitoylation, the addition of palmitate to specific cysteine residues of target proteins. This posttranslational modification increases protein hydrophobicity, affecting localization, stability, and function of modified proteins. Research has established that akr1 plays crucial roles in various cellular processes, particularly during meiosis, where it mediates the S-palmitoylation of proteins involved in nuclear fusion .

How does akr1 differ from other palmitoyltransferases in S. pombe?

Akr1 and the Erf2-Erf4 complex represent distinct palmitoyltransferases in S. pombe with different substrate specificities and cellular functions. While akr1 primarily S-palmitoylates the nuclear fusion protein Tht1 to regulate karyogamy during meiosis, the Erf2-Erf4 complex S-palmitoylates Ras1 at cysteine residue 215, which is required for Ras1 localization at the cell periphery and enrichment at the cell conjugation site for mating pheromone response. Additionally, Erf2-Erf4 also S-palmitoylates the spore coat protein Isp3 . This substrate specificity allows these palmitoyltransferases to regulate distinct processes during meiosis in S. pombe.

What is the cellular localization of akr1 in S. pombe?

Akr1 in S. pombe localizes to the endoplasmic reticulum (ER), consistent with its function as a palmitoyltransferase that modifies membrane-associated proteins. This localization is logical given that one of its primary substrates, the nuclear fusion protein Tht1, also localizes to the ER when properly S-palmitoylated . The ER localization positions akr1 optimally to modify proteins involved in nuclear membrane dynamics during meiosis.

What specific meiotic processes require akr1 activity?

Akr1 activity in S. pombe is specifically required during the karyogamy (nuclear fusion) stage of meiosis. Research has shown that in akr1 mutant cells, haploid nuclei fail to fuse properly during meiosis, leading to subsequent defects such as twin horsetail movement, unequal chromosome segregation, and aberrant spore formation . These defects were similar to those observed in tht1 mutants, consistent with akr1's role in S-palmitoylating Tht1. Interestingly, these meiotic defects were suppressed in azygotic meiosis, suggesting that akr1's role is specifically linked to the nuclear fusion events that occur in zygotic meiosis .

How does akr1-mediated S-palmitoylation influence nuclear fusion?

Akr1-mediated S-palmitoylation critically affects nuclear fusion during meiosis by stabilizing and properly localizing the nuclear fusion protein Tht1. When akr1 S-palmitoylates Tht1 at cysteine residues 65 and 78, it enables Tht1 to localize correctly to the ER, where Tht1 interacts with the Sey1 ER fusion GTPase . This interaction is essential for proper meiotic nuclear fusion. In the absence of akr1 or when the palmitoylation sites on Tht1 are mutated (Cys65Ala and Cys78Ala), Tht1 is both unstable (reduced protein levels) and mislocalized (forming cytoplasmic granule-like structures) . Consequently, nuclear fusion fails, resulting in unfused haploid nuclei, subsequent chromosome segregation defects, and aberrant spore formation.

What phenotypic defects result from akr1 deletion?

Deletion of akr1 in S. pombe results in several distinct phenotypic defects, primarily during meiosis. These include:

Phenotypic DefectDescription
Failed nuclear fusionHaploid nuclei remain unfused during karyogamy
Twin horsetail movementAbnormal chromosome dynamics during meiotic prophase
Chromosome segregation defectsUnequal distribution of genetic material
Aberrant spore formationAbnormalities in spore morphology and number
Tht1 mislocalizationFormation of granule-like structures instead of proper ER localization
Reduced Tht1 stabilityDecreased protein levels due to lack of S-palmitoylation

These phenotypes closely resemble those observed in tht1 mutants, confirming the functional relationship between akr1-mediated S-palmitoylation and Tht1 activity in nuclear fusion .

What are the known protein substrates of akr1 in S. pombe?

The primary known substrate of akr1 in S. pombe is Tht1 (twin horsetails protein 1), a meiosis-specific nuclear fusion protein. Research has demonstrated that akr1 S-palmitoylates Tht1 at cysteine residues 65 and 78, which is essential for Tht1's stability and proper localization to the ER . Without this modification, Tht1 is mislocalized and forms granule-like structures in the cytoplasm, leading to defects in nuclear fusion during meiosis. While Tht1 is the best-characterized substrate, other potential substrates of akr1 in S. pombe may exist but have not been extensively characterized in the available research.

What is the mechanism of akr1-mediated S-palmitoylation of Tht1?

Akr1 catalyzes the addition of palmitate groups to specific cysteine residues (Cys65 and Cys78) of Tht1 through S-palmitoylation. This posttranslational modification was confirmed through acyl-resin-assisted capture (acyl-RAC) experiments, which showed that GFP-Tht1 was S-palmitoylated in wild-type cells but significantly less so in akr1 mutant cells (only 27% compared to wild-type) . MALDI MS/MS analysis revealed the specific cysteine residues that are S-palmitoylated. This modification stabilizes Tht1 and ensures its proper localization to the ER, where it interacts with the Sey1 ER fusion GTPase to facilitate nuclear fusion during meiosis .

How does the S-palmitoylation of Tht1 affect its function and stability?

S-palmitoylation by akr1 has two major effects on Tht1:

What techniques are effective for detecting akr1-mediated protein palmitoylation?

Several methodological approaches are effective for studying akr1-mediated protein palmitoylation in S. pombe:

TechniqueDescriptionApplication
Acyl-Resin-Assisted Capture (acyl-RAC)Uses hydroxylamine to cleave thioester bonds between palmitate and cysteine, capturing revealed sulfhydryl groupsQuantitative comparison of palmitoylation levels between wild-type and akr1 mutant cells
MALDI MS/MS AnalysisMass spectrometry following protein purificationIdentification of specific S-palmitoylated cysteine residues (Cys65 and Cys78 in Tht1)
Fluorescent Protein FusionGFP-tagging of potential akr1 substratesVisualization of subcellular localization to detect mislocalization in akr1 mutants
Site-Directed MutagenesisReplacing cysteine residues with alanineConfirmation of specific palmitoylation sites through functional studies
Western BlottingProtein level analysisAssessment of protein stability differences between wild-type and akr1 mutants

These techniques were successfully employed to demonstrate the S-palmitoylation of Tht1 by akr1 and its functional significance .

How can recombinant akr1 be expressed for biochemical studies?

For expression of recombinant akr1 from S. pombe, researchers can utilize several approaches:

  • Expression Systems:

    • Baculovirus/insect cell expression system: Particularly suitable for membrane proteins like akr1, as demonstrated for other S. pombe proteins in the search results

    • S. pombe homologous expression: Using stable integration vectors (SIVs) that target different prototrophy genes

    • S. cerevisiae expression: A related yeast system that may provide appropriate post-translational modifications

  • Expression Constructs:

    • Utilize the thiamine-repressible nmt1 promoter for controlled expression, as successfully used for GFP-Tht1

    • Add appropriate affinity tags (His, GST, FLAG) for purification

    • Consider N-terminal fusion tags, as used successfully with GFP-Tht1

  • Vector Selection:

    • Use stable integration vectors (SIVs) that produce non-repetitive, stable genomic loci and integrate predominantly as single copy

    • Select appropriate auxotrophic markers (ura4+, leu1+, his3+, ade6+) or antibiotic resistance markers

What vectors are optimal for expressing recombinant akr1 in S. pombe?

Based on recent research in S. pombe molecular biology, stable integration vectors (SIVs) are recommended for expressing recombinant akr1 . These vectors overcome the instability issues associated with commonly used vectors that create repetitive genomic regions. SIVs:

  • Target different prototrophy genes (ura4, leu1, his3, ade6)

  • Produce non-repetitive, stable genomic loci

  • Integrate predominantly as single copy

  • Include complementary auxotrophic alleles that preclude false-positive integration events

  • Feature modular design with various promoters, fluorescent tags, and terminators

For membrane proteins like akr1, these vectors can be combined with appropriate regulatory elements such as the thiamine-repressible nmt1 promoter, which allows for controlled expression levels .

How might akr1 function coordinate with other posttranslational modifications during meiosis?

Akr1-mediated S-palmitoylation likely functions within a network of posttranslational modifications (PTMs) that orchestrate meiotic progression. Potential coordination mechanisms include:

  • Sequential modification: S-palmitoylation may precede or follow other modifications like phosphorylation or ubiquitination, creating a "PTM code" that regulates protein function during different meiotic stages.

  • Spatial organization: Various PTMs might target proteins to different subcellular compartments, with S-palmitoylation specifically targeting proteins to membrane structures like the ER .

  • Temporal regulation: Different PTMs may predominate at specific meiotic stages, with akr1-mediated S-palmitoylation being particularly critical during karyogamy.

  • Stability control: As demonstrated with Tht1, S-palmitoylation can stabilize proteins , potentially protecting them from ubiquitin-mediated degradation during specific meiotic windows.

  • Interaction modulation: S-palmitoylation may enhance or inhibit protein-protein interactions, as suggested by the requirement of Tht1 palmitoylation for its interaction with Sey1 .

What unresolved questions remain regarding akr1's role in S. pombe?

Despite significant advances in understanding akr1's function, several important questions remain:

  • Complete substrate repertoire: Is Tht1 the only substrate of akr1, or does it modify additional proteins involved in other cellular processes?

  • Regulation of akr1 activity: How is akr1's palmitoyltransferase activity regulated during the cell cycle and meiosis? Are there post-translational modifications or protein interactions that modulate its function?

  • Substrate recognition determinants: What sequence or structural features determine akr1's specificity for Tht1? Are there conserved motifs surrounding the palmitoylated cysteines?

  • Evolutionary conservation: How conserved is the function of akr1 across different yeast species and other eukaryotes? Do orthologous proteins perform similar roles in meiotic nuclear fusion?

  • Detailed mechanistic understanding: Precisely how does S-palmitoylation of Tht1 facilitate its interaction with Sey1 and subsequent nuclear fusion events?

What methodological challenges exist in studying akr1 function?

Researchers face several technical challenges when studying akr1:

  • Membrane protein biochemistry: As a membrane-associated protein, akr1 can be difficult to solubilize and purify while maintaining its native conformation and activity.

  • Dynamic nature of S-palmitoylation: The potentially reversible nature of S-palmitoylation makes it challenging to capture the full complement of modified proteins at any given time.

  • Meiosis-specific functions: Studying meiosis-specific processes requires specialized approaches to synchronize and monitor cells through the meiotic program.

  • Distinguishing direct from indirect effects: Determining whether phenotypes in akr1 mutants result directly from lack of Tht1 palmitoylation or from effects on other substrates requires careful experimental design.

  • Integrating with other cellular pathways: Understanding how akr1-mediated S-palmitoylation interfaces with other regulatory mechanisms during meiosis necessitates systems-level approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.