Recombinant Schizosaccharomyces pombe Palmitoyltransferase PFA5 (pfa-5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pfa-5; pi035; SPBC17A3.11; SPBC691.01; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pfa-5
Target Protein Sequence
MSTNLEEKQRRFSKLQKTLGVVFPAAILLSTGYTVWVFIALICVDSNIKIRNGYRNLGGG IVLIIFFFITSGLAYFSYFRVLFSSPSFCGNTLYTYYGFDNPIFLCGPNGAPRMCGTCKC WLPDRSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFYGFSAACMVLISTAIMI SRTYHYRSLPGTWIFVLVFSAFGVLFLGVMLVRHTGYLLLNINSHEAKNWKTRIYSFSVF FPEHMDSRVLVQSDPGDLPWDRGYSENWRAVMGDHWYNWILPLRRSPGDGEHFLYSPSFV SKMQSKALSMNS
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family, PFA5 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does PFA5 compare to other S. pombe palmitoylacyltransferases?

S. pombe contains five distinct palmitoylacyltransferases with differential localization and function:

PalmitoyltransferaseSubcellular LocalizationKnown Functions/SubstratesUnique Features
Akr1ER and GolgiS-palmitoylates Tht1 for nuclear fusion (karyogamy)Contains six ankyrin repeats for protein-protein interaction
Erf2-Erf4Cell periphery and GolgiS-palmitoylates Ras1 and Isp3 (spore coat protein)Requires Erf4 accessory protein
Pfa3Vacuole-like structuresNot fully characterized-
Pfa5Vacuole-like structuresNot fully characterizedUniProt ID: Q9C0W9
Swf1Endoplasmic reticulumEssential gene (unlike others)-

When disrupting these genes, the mutant phenotypes vary significantly. Erf2 and Erf4 mutants fail to generate zygotes for spore formation and are completely sterile, while Akr1 mutants show aberrant meiosis with unequal and inaccurate spore formation . Specific phenotypes for PFA5 deletion require further characterization.

Why is S. pombe particularly valuable for studying protein palmitoylation?

S. pombe serves as an excellent model for palmitoylation research for several key reasons:

  • Evolutionary position: S. pombe diverged from S. cerevisiae approximately a billion years ago and shares more genomic similarities with humans .

  • Conservation of key processes: S. pombe shares approximately 70% of genes with human orthologs, including many involved in disease , making findings potentially more translatable.

  • Simplified system: As a unicellular organism with a well-characterized genome published in 2002 , it offers a reduced-complexity system for studying fundamental mechanisms.

  • Powerful genetic tools: The availability of numerous assays developed for studying various processes in S. pombe facilitates research .

  • Cellular characteristics: S. pombe cells have distinct growth patterns and morphology that make certain phenotypes easily observable .

This combination of features has led to S. pombe being described as a "micromammal" , offering insights into processes conserved between yeasts and mammals while maintaining experimental tractability.

What specific assays have been developed for protein palmitoylation studies in S. pombe?

Several assays have been developed to study protein palmitoylation in S. pombe:

  • Metabolic labeling with palmitate analogs: Cells are incubated with clickable palmitate analogs (e.g., 17-ODYA), followed by click chemistry to attach detection tags for visualization.

  • Acyl-Biotin Exchange (ABE): A three-step process involving:

    • Blocking free thiols with N-ethylmaleimide

    • Selectively cleaving thioester bonds with hydroxylamine

    • Biotinylating newly exposed cysteines for detection

  • Palmitoyl-protein purification: Using recombinant His-tagged PFA5 (as described in catalogs ) for in vitro palmitoylation assays.

  • Genetic analysis: Creation of knockout strains for PFA5 (similar to other palmitoylacyltransferases) to assess phenotypic consequences .

  • Localization studies: Using GFP-tagged proteins to monitor changes in localization dependent on palmitoylation status .

These techniques can be combined with S. pombe's genetic tractability to create comprehensive approaches for identifying and characterizing palmitoylated proteins.

What is the optimal protocol for expressing and purifying recombinant PFA5?

Based on available commercial products and research protocols, the following optimized methodology is recommended:

Expression System:

  • Host: E. coli (successful expression documented in product descriptions)

  • Vector: Containing His-tag for purification

  • Construct: Full-length protein (1-312 amino acids)

Purification Protocol:

  • Cell lysis with appropriate detergents for membrane protein solubilization

  • Affinity chromatography using Ni-NTA resin for His-tagged protein

  • Buffer optimization: Tris/PBS-based buffer with 6% trehalose, pH 8.0

Critical Considerations:

  • Include protease inhibitors throughout purification

  • Maintain low temperature (4°C) during all steps

  • Consider detergent screening for optimal solubilization

  • Add glycerol (recommended 50% final concentration) for long-term storage

Storage Conditions:

  • Store at -20°C/-80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • Lyophilization may improve stability for long-term storage

For reconstitution, dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL prior to use .

How can researchers reliably detect PFA5-mediated protein palmitoylation in S. pombe?

Multiple complementary approaches can be used to detect and characterize PFA5-mediated palmitoylation:

1. Genetic Approach:

  • Create PFA5 deletion strains (similar to other palmitoylacyltransferases)

  • Compare palmitoylation profiles between wild-type and mutant strains

  • Perform complementation experiments with wild-type and catalytically dead mutants

2. Biochemical Detection Methods:

  • Acyl-Biotin Exchange (ABE): Most commonly used method that specifically detects palmitoylated proteins through selective hydroxylamine treatment

  • Metabolic Labeling: Incubate cells with clickable palmitate analogs for direct detection

  • Mass Spectrometry: For site-specific identification of palmitoylated cysteines

3. Substrate Validation:

  • For candidate substrates, create cysteine-to-serine mutations at potential palmitoylation sites

  • Analyze changes in protein localization, stability, and function

  • Perform in vitro palmitoylation assays with recombinant proteins

4. Visualization Techniques:

  • Create fluorescently tagged substrate proteins

  • Monitor localization changes in wild-type versus PFA5-deletion backgrounds

  • Perform fluorescence recovery after photobleaching (FRAP) to assess membrane dynamics

Essential controls include hydroxylamine-treated versus untreated samples, comparison with other palmitoyltransferase mutants, and validation with known palmitoylated proteins.

What are the key considerations for designing in vitro palmitoylation assays with recombinant PFA5?

When designing in vitro palmitoylation assays, several factors must be considered:

Reaction Components:

  • Purified recombinant PFA5 (His-tagged as available commercially)

  • Potential substrate proteins

  • Palmitoyl-CoA (radiolabeled, biotinylated, or clickable analogs)

  • Appropriate detergents to maintain PFA5 solubility

  • Mg²⁺ or Mn²⁺ as cofactors

  • Reducing agents (DTT or TCEP, at concentrations that don't interfere with palmitoylation)

Buffer Optimization:

  • pH 7.0-8.0 (typically optimal for palmitoyltransferase activity)

  • Ionic strength affects enzyme activity

  • Detergent concentration critical for membrane protein function

  • Consider including lipids to mimic native membrane environment

Detection Methods:

  • For radiolabeled palmitoyl-CoA: SDS-PAGE followed by autoradiography

  • For biotinylated palmitoyl-CoA: Western blot with streptavidin

  • For clickable analogs: Click chemistry followed by fluorescence detection

  • Mass spectrometry for site-specific identification

Essential Controls:

  • Catalytically inactive PFA5 (DHHC to DHHS mutation)

  • No-enzyme control

  • No-substrate control

  • Hydroxylamine treatment to confirm thioester linkage

  • Competition with non-labeled palmitoyl-CoA

Data Analysis:

  • Quantify signal intensity relative to controls

  • Calculate kinetic parameters if performing time-course experiments

  • Confirm specificity through mutational analysis of substrate cysteines

What strategies can be employed to identify novel PFA5 substrates?

Identifying novel PFA5 substrates requires a multi-faceted approach:

1. Comparative Proteomics:

  • Compare palmitoylated proteomes in wild-type versus PFA5-knockout S. pombe

  • Use techniques like ABE or acyl-RAC coupled with mass spectrometry

  • Apply stringent statistical analysis to identify significantly changed proteins

2. Localization-Based Screening:

  • Focus on proteins localized to vacuole-like structures (where PFA5 resides)

  • Examine proteins whose localization changes in PFA5-deficient cells

  • Create a library of GFP-tagged proteins and screen for localization changes

3. Bioinformatic Prediction:

  • Analyze known substrates for sequence motifs surrounding palmitoylated cysteines

  • Predict potential substrates based on these motifs

  • Focus on membrane-associated proteins with cysteines in suitable contexts

4. Physical Interaction Studies:

  • Perform co-immunoprecipitation with catalytically inactive PFA5

  • Use proximity labeling techniques (BioID or APEX) with PFA5 as the bait

  • Validate interactions with targeted approaches

5. Functional Validation:

  • Test candidate substrates in vitro with recombinant PFA5

  • Mutate potential palmitoylation sites and assess functional consequences

  • Perform rescue experiments with palmitoylation-mimetic constructs

For example, based on its vacuolar localization, PFA5 likely palmitoylates proteins involved in vacuolar function, membrane trafficking, or protein degradation pathways.

How can PFA5 research inform our understanding of protein palmitoylation in higher eukaryotes?

Research on S. pombe PFA5 provides valuable insights into palmitoylation mechanisms in higher eukaryotes:

1. Conservation of Core Machinery:

  • Human palmitoyltransferases (23 DHHC proteins) share the catalytic DHHC motif with S. pombe enzymes

  • Fundamental mechanisms of substrate recognition and catalysis likely conserved

2. Translational Implications:

  • Dysregulated palmitoylation is implicated in neurological disorders, cancer, and metabolic diseases

  • S. pombe provides a simplified system to study basic mechanisms that may apply to human disease contexts

3. Comparative Biology Approach:

  • Compare substrate specificity between S. pombe PFA5 and human orthologs

  • Identify conserved versus species-specific palmitoylation targets

  • Use S. pombe as a platform to test effects of disease-associated mutations

4. Methodological Advantages:

  • Develop and optimize techniques in S. pombe that can be applied to more complex systems

  • Use S. pombe to screen for modulators of palmitoylation before testing in mammalian systems

  • Leverage genetic tractability for pathway dissection impossible in higher eukaryotes

The finding that S. pombe palmitoyltransferases regulate multiple stages of meiosis suggests conserved roles in cellular differentiation that may extend to human development and disease.

What role does PFA5 play in meiosis and cellular differentiation in S. pombe?

While specific PFA5 functions in meiosis haven't been fully characterized, protein S-palmitoylation broadly impacts meiosis in S. pombe:

1. Known Palmitoyltransferase Functions in Meiosis:

  • Erf2-Erf4 complex: Required for mating pheromone response through Ras1 palmitoylation; mutants are completely sterile

  • Akr1: Essential for nuclear fusion (karyogamy) through Tht1 palmitoylation; mutants show aberrant meiosis

2. Potential PFA5 Roles Based on Localization:

  • Vacuolar processes during meiotic progression

  • Protein degradation pathways critical for meiotic transitions

  • Membrane remodeling during sporulation

3. Research Methodology to Determine PFA5 Meiotic Functions:

  • Create PFA5 deletion strains and assess meiotic phenotypes

  • Perform time-course analysis of protein palmitoylation throughout meiosis

  • Identify meiosis-specific substrates through differential proteomics

  • Use temperature-sensitive or conditional alleles to determine stage-specific requirements

4. Comparative Analysis:

  • Compare phenotypes across different palmitoyltransferase mutants

  • Determine if there is functional redundancy or specialization

  • Assess conservation with palmitoyltransferase functions in mammalian gametogenesis

The finding that protein S-palmitoylation is required at different stages of meiosis in S. pombe suggests PFA5 may have specific temporal roles that remain to be fully elucidated.

How can researchers differentiate between direct and indirect effects of PFA5 modification?

Distinguishing direct from indirect effects requires multiple complementary approaches:

1. Temporal Analysis:

  • Use rapid induction or repression systems to observe immediate versus delayed effects

  • Analyze the time course of changes following PFA5 manipulation

  • Establish the sequence of events to identify primary versus secondary effects

2. Direct Biochemical Validation:

  • Perform in vitro palmitoylation assays with purified components

  • Demonstrate physical interaction between PFA5 and putative substrates

  • Identify specific palmitoylation sites by mass spectrometry

  • Mutate these sites and assess functional consequences

3. Genetic Approaches:

  • Create catalytically inactive PFA5 mutants to separate binding from enzymatic activity

  • Perform epistasis analysis with known downstream factors

  • Use suppressor screens to identify compensatory pathways

4. Substrate-Specific Analysis:

  • Create palmitoylation-deficient mutants of candidate substrates

  • Determine if substrate mutation phenocopies PFA5 deletion

  • Test if artificial membrane targeting can bypass the need for palmitoylation

5. System-Level Analysis:

  • Perform time-resolved proteomics after PFA5 inactivation

  • Use network analysis to distinguish primary from secondary effects

  • Examine changes in multiple cellular pathways simultaneously

For example, in studying the role of Erf2-dependent palmitoylation of Ras1, researchers demonstrated direct effects by showing that a Ras1 cysteine 215 to alanine mutant phenocopied the erf2 deletion, confirming direct substrate modification .

What are the technical challenges in developing small molecule modulators of PFA5 activity?

Developing specific modulators of PFA5 presents several technical challenges:

1. Structural Challenges:

  • Limited high-resolution structural information on DHHC proteins

  • Multiple transmembrane domains complicate structural studies

  • Catalytic site accessibility for small molecules

2. Selectivity Issues:

  • Five palmitoyltransferases in S. pombe share the conserved DHHC motif

  • Distinguishing between PFA5 and other palmitoyltransferases

  • Avoiding off-target effects on other cysteine-rich proteins

3. Assay Development Difficulties:

  • Need for robust, high-throughput compatible assays

  • Challenges in developing cell-permeable probes

  • Validating target engagement in cellular contexts

4. Methodological Approaches:

  • Develop in vitro assays using recombinant PFA5 for screening

  • Create cellular assays monitoring palmitoylation of specific substrates

  • Implement counterscreens against other palmitoyltransferases

  • Validate hits using genetic approaches (e.g., testing if compounds phenocopy PFA5 deletion)

5. Alternative Strategies:

  • Target unique protein-protein interactions rather than the catalytic site

  • Focus on allosteric regulation of PFA5 activity

  • Consider substrate-selective inhibition approaches

For translational relevance, any modulators developed would need to be tested against human orthologs to assess conservation of binding and activity.

How does the regulation of PFA5 activity compare with other palmitoylacyltransferases in S. pombe?

The regulation of palmitoyltransferases in S. pombe occurs through multiple mechanisms:

1. Transcriptional Regulation:

  • Expression levels may vary during different growth phases or stress conditions

  • Meiosis-specific expression patterns for certain palmitoyltransferases have been observed

2. Protein Localization:

  • Different subcellular localizations restrict access to specific substrate pools

  • PFA5 localization to vacuole-like structures suggests specialized function

  • Dynamic changes in localization may occur in response to cellular conditions

3. Post-translational Modifications:

  • Palmitoyltransferases themselves can be subject to regulatory modifications

  • Auto-palmitoylation may regulate activity or localization

  • Other modifications (phosphorylation, ubiquitination) may affect stability or activity

4. Protein-Protein Interactions:

  • Some palmitoyltransferases require accessory proteins (e.g., Erf2 requires Erf4)

  • PFA5 may have specific interacting partners that modulate its activity

  • Substrate recruitment factors may influence specificity

5. Methodological Approaches to Study Regulation:

  • Time-course expression analysis across different conditions

  • Proteomic identification of post-translational modifications

  • Identification of binding partners through co-immunoprecipitation

  • Systematic mutagenesis to identify regulatory domains

Understanding these regulatory mechanisms is essential for developing strategies to selectively modulate PFA5 activity.

What are the best approaches to study PFA5 in the context of the complete palmitoylation/depalmitoylation cycle?

Protein palmitoylation is dynamically regulated through opposing activities of palmitoyltransferases and depalmitoylating enzymes:

1. Comprehensive Genetic Analysis:

  • Create single and combination mutants of palmitoyltransferases and depalmitoylases

  • Assess synthetic phenotypes that reveal functional relationships

  • Perform epistasis analysis to determine pathway organization

2. Dynamic Palmitoylation Analysis:

  • Pulse-chase experiments with clickable palmitate analogs

  • Calculate palmitate turnover rates on specific substrates

  • Compare dynamics in wild-type versus enzyme mutants

3. Live-Cell Imaging Approaches:

  • Develop biosensors that report on palmitoylation status in real-time

  • Use FRAP analysis to measure membrane association/dissociation rates

  • Track protein trafficking dependent on palmitoylation cycles

4. Mathematical Modeling:

  • Develop quantitative models of palmitoylation/depalmitoylation cycles

  • Predict system behavior under different conditions

  • Test model predictions experimentally

5. System-Level Analysis:

  • Analyze global palmitoylation patterns under different conditions

  • Identify regulatory feedback mechanisms between opposing enzymes

  • Determine how the balance affects cellular processes

This approach has been successfully employed to study other post-translational modifications in S. pombe, as described in assays developed for DNA damage repair mechanisms .

How can PFA5 research contribute to understanding human disease mechanisms?

Research on S. pombe PFA5 has several translational implications:

1. Conservation of Basic Mechanisms:

  • Fundamental principles of protein palmitoylation are conserved from yeast to humans

  • Insights from S. pombe can inform understanding of human palmitoyltransferases

2. Disease Relevance:

  • Dysregulated palmitoylation is implicated in:

    • Neurological disorders (Huntington's, Alzheimer's)

    • Cancer (altered signaling pathway regulation)

    • Developmental disorders

    • Infectious diseases (viral protein palmitoylation)

3. Therapeutic Target Validation:

  • Identify conserved substrates between S. pombe and humans

  • Validate the importance of specific palmitoylation events

  • Use S. pombe as a platform for initial drug discovery efforts

4. Methodological Translation:

  • Techniques optimized in S. pombe can be applied to human cells

  • High-throughput screens developed in yeast can be translated to mammalian systems

  • Genetic insights can guide more focused studies in complex systems

5. Specific Research Strategies:

  • Identify human orthologs of PFA5

  • Express human palmitoyltransferases in S. pombe to assess functional conservation

  • Test disease-associated mutations in the simplified S. pombe system

S. pombe's designation as a "micromammal" highlights its potential to bridge the gap between basic mechanisms and human disease applications.

What are the most critical variables to control when comparing palmitoylation studies across different experimental systems?

When comparing palmitoylation studies across experimental systems (in vitro, S. pombe, mammalian cells), several critical variables must be controlled:

1. Technical Variables:

  • Detection method sensitivity and specificity

  • Sample preparation procedures (potential loss of modifications)

  • Quantification methods and normalization approaches

  • Statistical analysis and significance thresholds

2. Biological Variables:

  • Cell growth conditions and metabolic state

  • Cell cycle stage and synchronization methods

  • Genetic background of strains used

  • Expression levels of recombinant proteins

3. Experimental Design Considerations:

  • Use of multiple orthogonal detection methods

  • Inclusion of appropriate positive and negative controls

  • Validation across different experimental systems

  • Confirmation of direct versus indirect effects

4. Cross-System Standardization:

  • Use conserved proteins as internal standards

  • Perform parallel experiments in different systems

  • Establish relative rather than absolute quantification

  • Focus on comparing patterns rather than individual values

5. Data Reporting Standards:

  • Detailed methodology documentation

  • Complete description of controls and replicates

  • Raw data availability for re-analysis

  • Thorough disclosure of limitations and confounding factors

For example, when studying PFAS in environmental samples, researchers found that different analytical methods (EPA Methods 537.1, 533, and 1633) produced significantly different results due to technical variables , highlighting the importance of standardized approaches.

What emerging technologies could enhance the study of PFA5 and protein palmitoylation?

Several cutting-edge technologies offer new opportunities for studying PFA5:

1. Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for membrane protein structures

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Integrative structural biology combining multiple data sources

2. Genome Editing Advances:

  • CRISPR-Cas9 for precise manipulation of endogenous genes

  • Base editing for introducing specific mutations without double-strand breaks

  • Prime editing for more complex genetic manipulations

3. Advanced Imaging Technologies:

  • Super-resolution microscopy for detailed subcellular localization

  • Single-molecule tracking to observe dynamics of individual proteins

  • Correlative light and electron microscopy for ultrastructural context

4. Chemical Biology Tools:

  • Photocaged or photoswitchable palmitoyl-CoA analogs

  • Genetically encodable biosensors for palmitoylation

  • Proximity-dependent labeling with improved spatial and temporal resolution

5. Systems Biology Approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Network analysis of palmitoylation-dependent processes

  • Machine learning for predicting palmitoylation sites and functional impacts

These technologies can be applied to S. pombe using established genetic and cellular tools, as demonstrated by the development of numerous assays for studying mitotic recombination and DNA damage repair .

How might artificial intelligence and computational approaches enhance PFA5 research?

AI and computational methods offer powerful tools for advancing PFA5 research:

1. Structure Prediction and Modeling:

  • Predict three-dimensional structures of PFA5 using AlphaFold or similar tools

  • Model protein-protein interactions between PFA5 and substrates

  • Simulate dynamic processes like membrane integration and substrate binding

2. Substrate Prediction:

  • Develop machine learning algorithms to predict palmitoylation sites

  • Train models on known substrates to identify new candidates

  • Incorporate contextual features beyond simple sequence motifs

3. Network Analysis:

  • Build interaction networks centered on PFA5 and other palmitoyltransferases

  • Identify functional modules affected by palmitoylation

  • Predict system-level consequences of PFA5 manipulation

4. Drug Discovery Applications:

  • Virtual screening for PFA5 modulators

  • Structure-based design of selective inhibitors

  • Predict off-target effects and optimize selectivity

5. Data Integration:

  • Integrate heterogeneous data from genomics, proteomics, and phenotypic studies

  • Extract patterns not obvious through traditional analysis

  • Generate testable hypotheses for experimental validation

These approaches can leverage existing datasets on S. pombe biology while providing new insights that guide experimental design, similar to the assays developed for studying DNA damage responses in fission yeast .

What are the most promising applications of engineered PFA5 variants in biotechnology?

Engineered PFA5 variants could serve several biotechnological applications:

1. Controlled Protein Localization Systems:

  • Create inducible palmitoylation systems for targeting proteins to membranes

  • Develop reversible membrane association tools for synthetic biology

  • Engineer substrate-specific variants for selective protein modification

2. Biosensor Development:

  • Create sensors that report on palmitoylation status in real-time

  • Develop screening platforms for modulators of palmitoylation enzymes

  • Design biosensors for detecting changes in membrane composition

3. Protein Engineering Applications:

  • Improve stability and expression of membrane proteins

  • Create novel palmitoylation-dependent protein switches

  • Develop self-assembling membrane protein systems

4. Therapeutic Protein Delivery:

  • Enhance membrane association of therapeutic proteins

  • Control protein half-life through regulated palmitoylation

  • Create targeted delivery systems for membrane-impermeable drugs

5. Methodological Applications:

  • Develop improved purification strategies for palmitoylated proteins

  • Create site-specific palmitoylation tools for proteomic studies

  • Engineer variants with broader or narrower substrate specificity

These applications could build on S. pombe's established role as a powerful model system for studying fundamental cellular processes .

How can the study of PFA5 in S. pombe inform our understanding of protein lipidation beyond palmitoylation?

Research on PFA5 provides insights into broader protein lipidation mechanisms:

1. Comparative Analysis of Lipid Modifications:

  • Compare palmitoylation with other lipid modifications (prenylation, myristoylation)

  • Identify common principles in enzyme recognition and specificity

  • Examine how different lipid modifications cooperate functionally

2. Lipid Specificity Determinants:

  • Investigate if PFA5 can utilize other fatty acid-CoA substrates

  • Determine structural features that dictate lipid specificity

  • Engineer variants with altered lipid preferences

3. Evolutionary Perspectives:

  • Compare lipidation mechanisms across evolutionary distant species

  • Identify conserved versus specialized functions

  • Understand how lipidation pathways co-evolved with cellular membranes

4. Integration with Membrane Biology:

  • Study how palmitoylation affects protein partitioning into membrane domains

  • Investigate interplay between membrane composition and palmitoylation efficiency

  • Examine how different lipid modifications target proteins to distinct membrane environments

5. Research Methodology:

  • Apply techniques developed for palmitoylation studies to other lipid modifications

  • Develop integrated approaches to study multiple modifications simultaneously

  • Create computational tools that predict and analyze diverse lipidation events

This broader perspective is particularly valuable given that S. pombe has unique cell wall composition compared to other yeasts, with α-(1,3)-glucan and virtual lack of chitin, along with terminal d-galactose sugars in mannan side-chains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.