Recombinant Schizosaccharomyces pombe Palmitoyltransferase swf1 (swf1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Palmitoyltransferase swf1 (swf1)

Recombinant Schizosaccharomyces pombe Palmitoyltransferase swf1 (swf1) is a recombinant protein derived from the fission yeast Schizosaccharomyces pombe. This enzyme belongs to the family of palmitoyltransferases, which are involved in the post-translational modification of proteins by adding palmitate groups. This process, known as palmitoylation, plays a crucial role in protein stability, localization, and function.

Characteristics of Recombinant swf1

  • Protein Sequence: The amino acid sequence of swf1 is well-defined, consisting of 356 amino acids. The sequence starts with MDFFYKYLALVAIASLMVFILLFGQIPKLKYTVIGKLNRFFMVTIPYHLHVLDSRYADGR CSAAMRSLSNYVLYKNNPLVVFLYLALITIGIASFFIYGSSLTQKFSIIDWISVLTSVLL PYISLYIAAKSNPGKIDLKNWNEASRRFPYDYKIFFPNKCSTCKFEKPARSKHCRLCNIC VEKFDHHCIWINNCVGLNNARYFFLFLLCTIQLLFHSILRLGYHFNALRDMRQYPSFLRS WWFAIKSEGELGSVFLISLICSVLVLCLLGYEFFLVYAGYTTNESEKWSDLAHLVKNRKV YMYYENGSQLLALDKDASNDAILVTSMSQIDNIYDNGFYNNFFSLVFPYRHLYSTT .

  • Function: Palmitoyltransferases like swf1 are involved in the palmitoylation of proteins, which affects their membrane association and interaction capabilities.

  • Expression and Purification: Recombinant swf1 is typically expressed in a suitable host system and purified using standard biochemical techniques.

Data Table: Characteristics of Recombinant swf1

CharacteristicDescription
SpeciesSchizosaccharomyces pombe (Fission Yeast)
Protein Length356 amino acids
SequenceAs described above
FunctionPalmitoyltransferase activity
Expression RegionSPBC13G1.07
Storage Conditions-20°C or -80°C for long-term storage

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
swf1; SPBC13G1.07; Palmitoyltransferase swf1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
swf1
Target Protein Sequence
MDFFYKYLALVAIASLMVFILLFGQIPKLKYTVIGKLNRFFMVTIPYHLHVLDSRYADGR CSAAMRSLSNYVLYKNNPLVVFLYLALITIGIASFFIYGSSLTQKFSIIDWISVLTSVLL PYISLYIAAKSNPGKIDLKNWNEASRRFPYDYKIFFPNKCSTCKFEKPARSKHCRLCNIC VEKFDHHCIWINNCVGLNNARYFFLFLLCTIQLLFHSILRLGYHFNALRDMRQYPSFLRS WWFAIKSEGELGSVFLISLICSVLVLCLLGYEFFLVYAGYTTNESEKWSDLAHLVKNRKV YMYYENGSQLLALDKDASNDAILVTSMSQIDNIYDNGFYNNFFSLVFPYRHLYSTT
Uniprot No.

Target Background

Function
Palmitoyltransferase that targets several endosomal SNAREs. It palmitoylates the SNAREs at cysteine residues near the cytoplasmic end of their transmembrane domain. This enzyme might play a role in the cellular quality control of transmembrane domain-containing proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, SWF1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Palmitoyltransferase swf1 and what is its significance in S. pombe?

Palmitoyltransferase swf1 (swf1) is an essential enzyme in S. pombe that catalyzes the addition of palmitate (a 16-carbon fatty acid) to specific cysteine residues of target proteins through thioester bonds. This process, known as S-palmitoylation, is crucial for various cellular functions. Swf1 is encoded by the essential swf1 gene (SPBC13G1.07) . Unlike other palmitoyltransferases in S. pombe, swf1 cannot be deleted without losing cell viability, indicating its essential role in fundamental cellular processes .

The protein consists of 356 amino acids with transmembrane domains and the characteristic DHHC motif (Asp-His-His-Cys) found in palmitoyltransferases . The essentiality of swf1, compared to non-essential palmitoyltransferases like Erf2-Erf4 and Akr1, suggests it targets proteins crucial for basic cellular functions rather than specialized processes like meiosis.

How does protein S-palmitoylation function in S. pombe cellular processes?

Protein S-palmitoylation in S. pombe regulates the localization and function of target proteins involved in diverse cellular processes. Research has demonstrated that this modification is particularly important during meiosis, including critical stages such as mating and karyogamy (nuclear fusion) .

The reversible nature of S-palmitoylation makes it a dynamic regulatory mechanism that can:

  • Target proteins to specific membrane compartments

  • Stabilize proteins, as demonstrated with the Tht1 protein

  • Regulate protein-protein interactions

  • Modulate protein conformation and activity

Unlike other post-translational modifications, S-palmitoylation is unique in its ability to confer membrane association to soluble proteins or stabilize transmembrane proteins within lipid bilayers.

How does swf1 compare with other palmitoyltransferases in S. pombe?

S. pombe contains multiple palmitoyltransferases with distinct functions and substrate specificities:

PalmitoyltransferaseEssentialityKnown FunctionKnown SubstratesLocalization
swf1EssentialUnknown but crucial for viabilityNot identified in search resultsLikely ER/membrane-bound
Erf2-Erf4 complexNon-essentialRequired for mating pheromone responseRas1 (Cys215), Isp3 (spore coat protein)Cell periphery
Akr1Non-essentialRequired for nuclear fusion in meiosisTht1 (Cys65, Cys78)ER membrane

While Erf2-Erf4 and Akr1 have specific roles in meiotic processes, swf1 appears to have essential functions in basic cellular processes required for viability . The substrate specificity of these enzymes is determined by both their catalytic domains and additional structural elements that mediate protein-protein interactions.

What techniques are available for detecting S-palmitoylation of swf1 substrates?

Several complementary techniques can be used to detect and analyze protein S-palmitoylation:

  • Acyl-Resin-Assisted Capture (Acyl-RAC): As demonstrated with Tht1 palmitoylation by Akr1, this technique uses hydroxylamine to cleave thioester bonds between palmitate and cysteine residues, generating free sulfhydryl groups that can be captured by thioreactive sepharose .

  • Metabolic Labeling: Incorporation of bioorthogonal palmitic acid analogs (e.g., 17-ODYA) followed by click chemistry to attach detection tags.

  • Mass Spectrometry Analysis: As used to identify palmitoylation sites (Cys65 and Cys78) on Tht1, MS/MS analysis after enrichment can precisely map modified residues .

  • Fatty Acid Exchange Labeling: Similar to Acyl-RAC but using different chemistries to exchange palmitate for detectable probes.

  • Subcellular Localization Changes: Monitoring changes in protein localization when palmitoylation is disrupted, as seen with Ras1 mislocalization in the absence of Erf2 .

What experimental approaches are used to study swf1 function given its essential nature?

Since swf1 is an essential gene in S. pombe, traditional gene knockout approaches are not viable for functional studies . Researchers can employ alternative strategies:

  • Conditional Expression Systems:

    • Using regulatable promoters like the thiamine-repressible nmt1 promoter (as mentioned for Tht1 expression studies)

    • Auxin-inducible degron systems for rapid protein depletion

    • Temperature-sensitive degron systems

  • Partial Loss-of-Function Mutations:

    • Site-directed mutagenesis of key residues in the DHHC domain

    • Temperature-sensitive alleles that maintain function at permissive temperatures

    • Domain deletion or substitution approaches that maintain viability but alter function

  • Chemical Genetics:

    • Small molecule inhibitors of palmitoyltransferase activity

    • Analog-sensitive mutants that are uniquely susceptible to specific inhibitors

  • Substrate Identification Strategies:

    • Proximity labeling approaches (BioID, APEX) to identify proteins in close association

    • Comparative proteomic analysis of palmitoylated proteins under swf1-depleted conditions

    • Genetic screens for synthetic interactions with conditional swf1 mutants

How can researchers express and purify functional recombinant swf1 protein?

Based on the product information provided for recombinant swf1 and best practices for membrane protein purification, researchers should consider:

Expression Systems:

  • Yeast Expression: Homologous expression in S. pombe or heterologous expression in S. cerevisiae

  • Insect Cell Systems: Baculovirus-infected Sf9 or Hi5 cells for eukaryotic post-translational processing

  • Mammalian Expression: HEK293 or CHO cells for complex membrane proteins

  • Cell-Free Systems: For difficult-to-express membrane proteins

Purification Strategy:

  • Vector Design:

    • Incorporate affinity tags (His6, GST, FLAG) at termini least likely to interfere with function

    • Include protease cleavage sites for tag removal

    • Consider fusion partners to enhance solubility

  • Membrane Extraction:

    • Optimize detergent selection (DDM, LMNG, GDN) for membrane solubilization

    • Consider nanodiscs or amphipols for maintaining native environment

  • Chromatography Steps:

    • Affinity chromatography based on incorporated tags

    • Size exclusion chromatography for removing aggregates

    • Ion exchange chromatography for further purification

  • Quality Control:

    • SDS-PAGE and Western blot for purity assessment

    • Mass spectrometry for identity confirmation

    • Activity assays to confirm functional state

  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C as recommended

    • Consider flash freezing in liquid nitrogen with cryoprotectants

    • Validate activity retention after freeze-thaw cycles

What methods are used to measure the enzymatic activity of recombinant swf1?

Palmitoyltransferase activity can be measured through several complementary approaches:

In Vitro Enzymatic Assays:

  • Radioactive Assays:

    • Incubate purified swf1 with ³H or ¹⁴C-labeled palmitoyl-CoA and candidate substrate proteins

    • Measure incorporation of radioactivity into substrate proteins

    • Perform kinetic analyses to determine Km and Vmax values

  • Fluorescence-Based Assays:

    • Use fluorescently labeled palmitoyl-CoA analogs

    • Monitor changes in fluorescence upon substrate modification

    • Suitable for high-throughput screening applications

  • Click Chemistry-Based Assays:

    • Utilize alkyne or azide-modified palmitoyl-CoA

    • Perform click chemistry to attach detection tags post-reaction

    • Visualize or quantify modified substrates

In Vivo Activity Assessment:

  • Complementation Assays:

    • Rescue swf1 conditional mutant phenotypes with wild-type or mutant constructs

    • Quantify restoration of normal cellular functions

  • Substrate Localization:

    • Monitor changes in substrate protein localization upon swf1 manipulation

    • Similar to the approach used to demonstrate Ras1 mislocalization in erf2 mutants

  • Acyl-RAC Analysis:

    • Compare palmitoylation levels of candidate substrates in normal versus swf1-depleted conditions

    • Similar to the approach used to demonstrate decreased Tht1 palmitoylation in akr1 mutants

How do mutations in the DHHC domain affect swf1 enzymatic activity?

The DHHC domain is critical for palmitoyltransferase activity, with specific residues playing distinct roles:

Functional Significance of Key Residues:

  • Cysteine Residue:

    • Forms the palmitoyl-enzyme intermediate during catalysis

    • Mutation to alanine or serine typically abolishes enzymatic activity

    • Can be used to create catalytically dead mutants for mechanistic studies

  • Histidine Residues:

    • Coordinate zinc ions for structural stability

    • Contribute to the reaction mechanism as potential acid/base catalysts

    • Mutation can disrupt both structure and catalytic function

  • Aspartic Acid Residue:

    • May participate in substrate binding or catalysis

    • Often conserved across DHHC proteins

Experimental Approaches:

  • Site-Directed Mutagenesis:

    • Create specific mutations in the DHHC motif

    • Express and purify mutant proteins

    • Compare enzymatic activity with wild-type protein

  • Structural Analysis:

    • Use X-ray crystallography or cryo-EM to determine structural changes

    • Compare with structures of related DHHC proteins from other organisms

  • Molecular Dynamics Simulations:

    • Model the effects of mutations on protein dynamics and substrate interactions

    • Predict compensatory mutations that might restore function

What is the relationship between swf1 and meiotic processes in S. pombe?

While the search results indicate that swf1 is an essential gene required for viability (unlike the meiosis-specific palmitoyltransferases Erf2-Erf4 and Akr1) , its potential contributions to meiotic processes can be investigated:

Potential Roles in Meiosis:

  • Pre-meiotic Cellular Preparation:

    • Palmitoylation of proteins involved in nutrient sensing or starvation response

    • Modification of cell cycle regulators that influence the mitosis-to-meiosis transition

  • Substrate Overlap:

    • Palmitoylation of proteins that are also substrates of meiosis-specific palmitoyltransferases

    • Potential redundancy in function under certain conditions

  • Cellular Infrastructure:

    • Maintenance of membrane structures required for both mitotic and meiotic processes

    • Protein trafficking pathways shared between growth and differentiation

Experimental Approaches:

  • Conditional Depletion During Meiosis:

    • Use of degron-tagged swf1 to deplete the protein specifically during meiosis

    • Analysis of meiotic progression, nuclear organization, and spore formation

  • Protein-Protein Interaction Studies:

    • Identify swf1 interactions with meiosis-specific proteins

    • Compare interactomes between vegetative growth and meiotic conditions

  • Complementation Experiments:

    • Determine if overexpression of other palmitoyltransferases can compensate for reduced swf1 function

    • Test if swf1 can complement defects in erf2/erf4 or akr1 mutants

How do researchers identify the specific substrates of swf1 in S. pombe?

Identifying palmitoyltransferase substrates remains challenging due to the potential for hundreds of targets and the reversible nature of the modification. Several complementary approaches can be employed:

Substrate Identification Strategies:

  • Proteomics Approaches:

    • Global Palmitoylome Analysis: Compare palmitoylated proteins in cells with normal versus reduced swf1 activity

    • Proximity Labeling: Tag swf1 with BioID or APEX2 to identify proteins in close proximity

    • Stable Isotope Labeling: Quantitative comparison of palmitoylation levels between conditions

  • Candidate-Based Approaches:

    • Prediction Algorithms: Computational prediction of palmitoylation sites in proteins

    • Homology-Based Identification: Testing S. pombe homologs of known substrates from other organisms

    • Synthetic Genetic Arrays: Identifying genetic interactions between swf1 and potential substrate genes

  • Biochemical Validation:

    • In Vitro Palmitoylation Assays: Testing direct modification of candidate proteins by purified swf1

    • Site-Directed Mutagenesis: Mutating predicted palmitoylation sites to confirm their functional significance

    • Acyl-RAC Assays: Confirming palmitoylation status of specific proteins, similar to the approach used for Tht1

Data Analysis Framework:

Confidence LevelCriteria for Substrate Verification
Level 1Protein shows reduced palmitoylation in swf1-depleted cells
Level 2Protein is directly palmitoylated by swf1 in vitro
Level 3Specific palmitoylation site(s) identified by MS/MS
Level 4Mutation of site(s) phenocopies swf1 depletion effects
Level 5Structure of swf1-substrate complex resolved

What is the significance of swf1 in S. pombe compared to other model organisms?

Comparative analysis of swf1 across species provides evolutionary context and can reveal conserved functions:

Evolutionary Conservation:

  • Saccharomyces cerevisiae:

    • Swf1p is the S. cerevisiae ortholog with similar DHHC domain organization

    • Functions in maintaining integrity of membrane compartments

    • Not essential under standard conditions, unlike S. pombe swf1

  • Mammals:

    • ZDHHC-family proteins (23 in humans) are related to yeast palmitoyltransferases

    • Several ZDHHC proteins have been implicated in disease processes

    • Greater complexity with more specialized functions

Experimental Approaches for Comparative Studies:

  • Heterologous Expression:

    • Express mammalian ZDHHC proteins in swf1 conditional mutants

    • Test for functional complementation

  • Domain Swapping:

    • Create chimeric proteins combining domains from swf1 and related proteins

    • Map functional domains and substrate specificity determinants

  • Substrate Conservation:

    • Compare substrates of swf1 with those of orthologous enzymes in other organisms

    • Identify evolutionarily conserved palmitoylation targets

How is swf1 expression and activity regulated under different cellular conditions?

Understanding the regulation of swf1 can provide insights into how S-palmitoylation is coordinated with other cellular processes:

Potential Regulatory Mechanisms:

  • Transcriptional Regulation:

    • Changes in swf1 mRNA levels during cell cycle or in response to stressors

    • Potential coordination with expression of substrate proteins

  • Post-translational Modifications:

    • Phosphorylation, ubiquitination, or other modifications affecting swf1 activity

    • Auto-palmitoylation as a regulatory mechanism

  • Protein-Protein Interactions:

    • Association with regulatory partners similar to the Erf2-Erf4 complex

    • Substrate availability and competition

  • Subcellular Localization:

    • Changes in swf1 distribution under different conditions

    • Compartmentalization affecting access to substrates

Experimental Approaches:

  • Reporter Systems:

    • swf1 promoter fused to fluorescent proteins to monitor expression

    • FRET-based sensors to detect conformational changes or activity

  • Quantitative Analysis:

    • RT-qPCR and Western blotting to measure expression levels

    • Proteomics to identify post-translational modifications

  • Imaging Studies:

    • Live cell imaging of tagged swf1 under different conditions

    • Co-localization studies with known markers and substrates

By addressing these questions with rigorous experimental approaches, researchers can advance our understanding of this essential palmitoyltransferase and its critical roles in S. pombe biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.