Recombinant Schizosaccharomyces pombe Palmitoyltransferase swf1 (swf1) is a recombinant protein derived from the fission yeast Schizosaccharomyces pombe. This enzyme belongs to the family of palmitoyltransferases, which are involved in the post-translational modification of proteins by adding palmitate groups. This process, known as palmitoylation, plays a crucial role in protein stability, localization, and function.
Protein Sequence: The amino acid sequence of swf1 is well-defined, consisting of 356 amino acids. The sequence starts with MDFFYKYLALVAIASLMVFILLFGQIPKLKYTVIGKLNRFFMVTIPYHLHVLDSRYADGR CSAAMRSLSNYVLYKNNPLVVFLYLALITIGIASFFIYGSSLTQKFSIIDWISVLTSVLL PYISLYIAAKSNPGKIDLKNWNEASRRFPYDYKIFFPNKCSTCKFEKPARSKHCRLCNIC VEKFDHHCIWINNCVGLNNARYFFLFLLCTIQLLFHSILRLGYHFNALRDMRQYPSFLRS WWFAIKSEGELGSVFLISLICSVLVLCLLGYEFFLVYAGYTTNESEKWSDLAHLVKNRKV YMYYENGSQLLALDKDASNDAILVTSMSQIDNIYDNGFYNNFFSLVFPYRHLYSTT .
Function: Palmitoyltransferases like swf1 are involved in the palmitoylation of proteins, which affects their membrane association and interaction capabilities.
Expression and Purification: Recombinant swf1 is typically expressed in a suitable host system and purified using standard biochemical techniques.
| Characteristic | Description |
|---|---|
| Species | Schizosaccharomyces pombe (Fission Yeast) |
| Protein Length | 356 amino acids |
| Sequence | As described above |
| Function | Palmitoyltransferase activity |
| Expression Region | SPBC13G1.07 |
| Storage Conditions | -20°C or -80°C for long-term storage |
KEGG: spo:SPBC13G1.07
STRING: 4896.SPBC13G1.07.1
Palmitoyltransferase swf1 (swf1) is an essential enzyme in S. pombe that catalyzes the addition of palmitate (a 16-carbon fatty acid) to specific cysteine residues of target proteins through thioester bonds. This process, known as S-palmitoylation, is crucial for various cellular functions. Swf1 is encoded by the essential swf1 gene (SPBC13G1.07) . Unlike other palmitoyltransferases in S. pombe, swf1 cannot be deleted without losing cell viability, indicating its essential role in fundamental cellular processes .
The protein consists of 356 amino acids with transmembrane domains and the characteristic DHHC motif (Asp-His-His-Cys) found in palmitoyltransferases . The essentiality of swf1, compared to non-essential palmitoyltransferases like Erf2-Erf4 and Akr1, suggests it targets proteins crucial for basic cellular functions rather than specialized processes like meiosis.
Protein S-palmitoylation in S. pombe regulates the localization and function of target proteins involved in diverse cellular processes. Research has demonstrated that this modification is particularly important during meiosis, including critical stages such as mating and karyogamy (nuclear fusion) .
The reversible nature of S-palmitoylation makes it a dynamic regulatory mechanism that can:
Target proteins to specific membrane compartments
Stabilize proteins, as demonstrated with the Tht1 protein
Regulate protein-protein interactions
Modulate protein conformation and activity
Unlike other post-translational modifications, S-palmitoylation is unique in its ability to confer membrane association to soluble proteins or stabilize transmembrane proteins within lipid bilayers.
S. pombe contains multiple palmitoyltransferases with distinct functions and substrate specificities:
| Palmitoyltransferase | Essentiality | Known Function | Known Substrates | Localization |
|---|---|---|---|---|
| swf1 | Essential | Unknown but crucial for viability | Not identified in search results | Likely ER/membrane-bound |
| Erf2-Erf4 complex | Non-essential | Required for mating pheromone response | Ras1 (Cys215), Isp3 (spore coat protein) | Cell periphery |
| Akr1 | Non-essential | Required for nuclear fusion in meiosis | Tht1 (Cys65, Cys78) | ER membrane |
While Erf2-Erf4 and Akr1 have specific roles in meiotic processes, swf1 appears to have essential functions in basic cellular processes required for viability . The substrate specificity of these enzymes is determined by both their catalytic domains and additional structural elements that mediate protein-protein interactions.
Several complementary techniques can be used to detect and analyze protein S-palmitoylation:
Acyl-Resin-Assisted Capture (Acyl-RAC): As demonstrated with Tht1 palmitoylation by Akr1, this technique uses hydroxylamine to cleave thioester bonds between palmitate and cysteine residues, generating free sulfhydryl groups that can be captured by thioreactive sepharose .
Metabolic Labeling: Incorporation of bioorthogonal palmitic acid analogs (e.g., 17-ODYA) followed by click chemistry to attach detection tags.
Mass Spectrometry Analysis: As used to identify palmitoylation sites (Cys65 and Cys78) on Tht1, MS/MS analysis after enrichment can precisely map modified residues .
Fatty Acid Exchange Labeling: Similar to Acyl-RAC but using different chemistries to exchange palmitate for detectable probes.
Subcellular Localization Changes: Monitoring changes in protein localization when palmitoylation is disrupted, as seen with Ras1 mislocalization in the absence of Erf2 .
Since swf1 is an essential gene in S. pombe, traditional gene knockout approaches are not viable for functional studies . Researchers can employ alternative strategies:
Conditional Expression Systems:
Partial Loss-of-Function Mutations:
Site-directed mutagenesis of key residues in the DHHC domain
Temperature-sensitive alleles that maintain function at permissive temperatures
Domain deletion or substitution approaches that maintain viability but alter function
Chemical Genetics:
Small molecule inhibitors of palmitoyltransferase activity
Analog-sensitive mutants that are uniquely susceptible to specific inhibitors
Substrate Identification Strategies:
Proximity labeling approaches (BioID, APEX) to identify proteins in close association
Comparative proteomic analysis of palmitoylated proteins under swf1-depleted conditions
Genetic screens for synthetic interactions with conditional swf1 mutants
Based on the product information provided for recombinant swf1 and best practices for membrane protein purification, researchers should consider:
Yeast Expression: Homologous expression in S. pombe or heterologous expression in S. cerevisiae
Insect Cell Systems: Baculovirus-infected Sf9 or Hi5 cells for eukaryotic post-translational processing
Mammalian Expression: HEK293 or CHO cells for complex membrane proteins
Cell-Free Systems: For difficult-to-express membrane proteins
Vector Design:
Incorporate affinity tags (His6, GST, FLAG) at termini least likely to interfere with function
Include protease cleavage sites for tag removal
Consider fusion partners to enhance solubility
Membrane Extraction:
Optimize detergent selection (DDM, LMNG, GDN) for membrane solubilization
Consider nanodiscs or amphipols for maintaining native environment
Chromatography Steps:
Affinity chromatography based on incorporated tags
Size exclusion chromatography for removing aggregates
Ion exchange chromatography for further purification
Quality Control:
SDS-PAGE and Western blot for purity assessment
Mass spectrometry for identity confirmation
Activity assays to confirm functional state
Storage Conditions:
Palmitoyltransferase activity can be measured through several complementary approaches:
Radioactive Assays:
Incubate purified swf1 with ³H or ¹⁴C-labeled palmitoyl-CoA and candidate substrate proteins
Measure incorporation of radioactivity into substrate proteins
Perform kinetic analyses to determine Km and Vmax values
Fluorescence-Based Assays:
Use fluorescently labeled palmitoyl-CoA analogs
Monitor changes in fluorescence upon substrate modification
Suitable for high-throughput screening applications
Click Chemistry-Based Assays:
Utilize alkyne or azide-modified palmitoyl-CoA
Perform click chemistry to attach detection tags post-reaction
Visualize or quantify modified substrates
Complementation Assays:
Rescue swf1 conditional mutant phenotypes with wild-type or mutant constructs
Quantify restoration of normal cellular functions
Substrate Localization:
Acyl-RAC Analysis:
The DHHC domain is critical for palmitoyltransferase activity, with specific residues playing distinct roles:
Cysteine Residue:
Forms the palmitoyl-enzyme intermediate during catalysis
Mutation to alanine or serine typically abolishes enzymatic activity
Can be used to create catalytically dead mutants for mechanistic studies
Histidine Residues:
Coordinate zinc ions for structural stability
Contribute to the reaction mechanism as potential acid/base catalysts
Mutation can disrupt both structure and catalytic function
Aspartic Acid Residue:
May participate in substrate binding or catalysis
Often conserved across DHHC proteins
Site-Directed Mutagenesis:
Create specific mutations in the DHHC motif
Express and purify mutant proteins
Compare enzymatic activity with wild-type protein
Structural Analysis:
Use X-ray crystallography or cryo-EM to determine structural changes
Compare with structures of related DHHC proteins from other organisms
Molecular Dynamics Simulations:
Model the effects of mutations on protein dynamics and substrate interactions
Predict compensatory mutations that might restore function
While the search results indicate that swf1 is an essential gene required for viability (unlike the meiosis-specific palmitoyltransferases Erf2-Erf4 and Akr1) , its potential contributions to meiotic processes can be investigated:
Pre-meiotic Cellular Preparation:
Palmitoylation of proteins involved in nutrient sensing or starvation response
Modification of cell cycle regulators that influence the mitosis-to-meiosis transition
Substrate Overlap:
Palmitoylation of proteins that are also substrates of meiosis-specific palmitoyltransferases
Potential redundancy in function under certain conditions
Cellular Infrastructure:
Maintenance of membrane structures required for both mitotic and meiotic processes
Protein trafficking pathways shared between growth and differentiation
Conditional Depletion During Meiosis:
Use of degron-tagged swf1 to deplete the protein specifically during meiosis
Analysis of meiotic progression, nuclear organization, and spore formation
Protein-Protein Interaction Studies:
Identify swf1 interactions with meiosis-specific proteins
Compare interactomes between vegetative growth and meiotic conditions
Complementation Experiments:
Determine if overexpression of other palmitoyltransferases can compensate for reduced swf1 function
Test if swf1 can complement defects in erf2/erf4 or akr1 mutants
Identifying palmitoyltransferase substrates remains challenging due to the potential for hundreds of targets and the reversible nature of the modification. Several complementary approaches can be employed:
Proteomics Approaches:
Global Palmitoylome Analysis: Compare palmitoylated proteins in cells with normal versus reduced swf1 activity
Proximity Labeling: Tag swf1 with BioID or APEX2 to identify proteins in close proximity
Stable Isotope Labeling: Quantitative comparison of palmitoylation levels between conditions
Candidate-Based Approaches:
Prediction Algorithms: Computational prediction of palmitoylation sites in proteins
Homology-Based Identification: Testing S. pombe homologs of known substrates from other organisms
Synthetic Genetic Arrays: Identifying genetic interactions between swf1 and potential substrate genes
Biochemical Validation:
In Vitro Palmitoylation Assays: Testing direct modification of candidate proteins by purified swf1
Site-Directed Mutagenesis: Mutating predicted palmitoylation sites to confirm their functional significance
Acyl-RAC Assays: Confirming palmitoylation status of specific proteins, similar to the approach used for Tht1
| Confidence Level | Criteria for Substrate Verification |
|---|---|
| Level 1 | Protein shows reduced palmitoylation in swf1-depleted cells |
| Level 2 | Protein is directly palmitoylated by swf1 in vitro |
| Level 3 | Specific palmitoylation site(s) identified by MS/MS |
| Level 4 | Mutation of site(s) phenocopies swf1 depletion effects |
| Level 5 | Structure of swf1-substrate complex resolved |
Comparative analysis of swf1 across species provides evolutionary context and can reveal conserved functions:
Saccharomyces cerevisiae:
Swf1p is the S. cerevisiae ortholog with similar DHHC domain organization
Functions in maintaining integrity of membrane compartments
Not essential under standard conditions, unlike S. pombe swf1
Mammals:
ZDHHC-family proteins (23 in humans) are related to yeast palmitoyltransferases
Several ZDHHC proteins have been implicated in disease processes
Greater complexity with more specialized functions
Heterologous Expression:
Express mammalian ZDHHC proteins in swf1 conditional mutants
Test for functional complementation
Domain Swapping:
Create chimeric proteins combining domains from swf1 and related proteins
Map functional domains and substrate specificity determinants
Substrate Conservation:
Compare substrates of swf1 with those of orthologous enzymes in other organisms
Identify evolutionarily conserved palmitoylation targets
Understanding the regulation of swf1 can provide insights into how S-palmitoylation is coordinated with other cellular processes:
Transcriptional Regulation:
Changes in swf1 mRNA levels during cell cycle or in response to stressors
Potential coordination with expression of substrate proteins
Post-translational Modifications:
Phosphorylation, ubiquitination, or other modifications affecting swf1 activity
Auto-palmitoylation as a regulatory mechanism
Protein-Protein Interactions:
Subcellular Localization:
Changes in swf1 distribution under different conditions
Compartmentalization affecting access to substrates
Reporter Systems:
swf1 promoter fused to fluorescent proteins to monitor expression
FRET-based sensors to detect conformational changes or activity
Quantitative Analysis:
RT-qPCR and Western blotting to measure expression levels
Proteomics to identify post-translational modifications
Imaging Studies:
Live cell imaging of tagged swf1 under different conditions
Co-localization studies with known markers and substrates
By addressing these questions with rigorous experimental approaches, researchers can advance our understanding of this essential palmitoyltransferase and its critical roles in S. pombe biology.