Recombinant Schizosaccharomyces pombe Peroxisomal membrane protein pex32 (pex32)

Shipped with Ice Packs
In Stock

Description

Overview of Schizosaccharomyces pombe

Schizosaccharomyces pombe, also known as fission yeast, serves as a valuable model organism in biological research due to its similarities to human cells in several key areas, including mitochondrial inheritance, sugar metabolism, and dependence on the mitogenome for viability . Genetic studies using S. pombe have identified around 50 genes associated with diseases like diabetes, cystic fibrosis, and hereditary deafness, further underscoring its relevance to human health research .

Peroxisomes and Peroxins

Peroxisomes are essential organelles involved in various metabolic functions, including the breakdown of fatty acids and the synthesis of certain lipids . Peroxins, or PEX proteins, are crucial for peroxisome biogenesis, proliferation, and function . These proteins facilitate the import of other proteins into the peroxisome matrix and the assembly of the peroxisomal membrane .

Identification and Function of Pex32

Pex32 is part of a family of peroxisomal integral membrane proteins that includes Pex30 and Pex31 . Originally identified as Ybr168p in Saccharomyces cerevisiae, Pex32, along with Pex30 and Pex31, plays a role in regulating peroxisome size and number .

Pex32 in Saccharomyces cerevisiae

In Saccharomyces cerevisiae, deletion of the YBR168w gene, which encodes Pex32, results in cells exhibiting enlarged peroxisomes . Pex32 interacts with other peroxins like Pex28p and Pex29p, which also regulate peroxisome size and number . These interactions suggest that Pex32 functions within a complex network to control peroxisome proliferation .

Pex32 Localization and Interactions

Pex32, along with other members of the Pex23 family, has been found to localize to the endoplasmic reticulum (ER) in addition to peroxisomes . Some studies suggest exclusive localization at ER subdomains, where it may be involved in peroxisome-ER contact sites . Pex32 interacts with other proteins, such as Pex4p, anchoring it to the peroxisomal membrane .

Role in Iron Homeostasis

Schizosaccharomyces pombe utilizes transcription factors such as Fep1 and Php4 to regulate intracellular iron levels, which are controlled by Grx4 . While Pex32 itself is not directly implicated in iron homeostasis, understanding the regulatory mechanisms involving Grx4, Fep1, and Php4 provides a broader context for studying metabolic processes within S. pombe .

Essentiality of Genes in Schizosaccharomyces pombe

Research into Schizosaccharomyces pombe has also focused on identifying essential genes required for vegetative growth . Deletion studies have revealed that approximately 17.5% of genes are essential . Although Pex32 itself was not specifically identified as essential in these studies, the broader effort to characterize gene essentiality contributes to understanding the functional importance of individual proteins within the organism .

Pex36: A Functional Homolog of Mammalian PEX16

Pex36, a peroxin in yeasts, functions similarly to mammalian PEX16 in the ER-to-peroxisome trafficking of peroxisomal membrane proteins (PMPs) . Studies show that Pex36 is an integral PMP with two predicted transmembrane spanning regions .

Data Table: Pex Protein Functions

ProteinOrganismFunction
Pex32Saccharomyces cerevisiaeRegulation of peroxisome size and number
Pex4pPichia pastorisAnchored by Pex22p on the peroxisomal membrane, involved in ubiquitination
Pex36YeastTrafficking of PMPs from the ER to peroxisomes
Pex28pSaccharomyces cerevisiaeRegulation of peroxisome size and number
Pex29pSaccharomyces cerevisiaeRegulation of peroxisome size and number

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pex32; SPCC550.09; Peroxisomal membrane protein pex32; Peroxin-32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pex32
Target Protein Sequence
MIRAHLFSEPDNSKLWAKSTGSDAFDLILKVLLWTAPWYYCLTTLFFTWLIILYPRPTLA CSVAAWLFWFTSLDTLEPDDRKNTLKASEAVSTSAKTSEETAKPSETREDGEWNTLKNTL EADAQNLMSGFQMLQRRWSQPKTTTLKTEVKEQQASQSPSVEGENEPAGVKSNEATKPSV TEEKEKNAEQNKRRERLSISHIVTELAKKDEVSSESGSNEIVNAKLKNEQLDSNFTLLDA YLEPLVHLHEYSRRSNTLFFFYLPIVMSILIFCLPTQALFIVLSSVFLAWHSPPLQAVLF CIRRISFFNLLYEKFVIGKTKEPAKPVPQPSSNEPPAPSAENKQPSVSSPEKKESPATHL LKVIGSSPYVVHSNHTNNTLTDKESSDPTEKCLYLIEHQRYWVGVGWLNRTLPTDPPNFT NAGSTDPVAEPTAQLLPPDGLAWIDDKWSISPWTFTDTFWAQPAKTQFRTAFTRSREWRR RYRVAPPAENEKPHTSRTNTASSLSSTSEDQVSTHGSISSAKVTAIPDSNGAEAL
Uniprot No.

Target Background

Database Links
Protein Families
PEX28-32 family, PEX32 subfamily
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Schizosaccharomyces pombe Pex32?

S. pombe Pex32 is a peroxisomal membrane protein with a complex structure consisting of N-terminal transmembrane domains and a C-terminal DysF domain. The complete amino acid sequence includes 535 residues with multiple transmembrane helices that anchor the protein predominantly in the ER membrane . Structurally, Pex32 belongs to the Pex23 protein family, which plays critical roles in peroxisome biogenesis and maintenance . The protein contains four predicted transmembrane helices in its N-terminal region, with the second transmembrane domain containing crucial ER targeting information, as demonstrated through localization studies of truncated variants .

What are the primary functions of Pex32 in peroxisome biology?

Pex32 serves as a critical component in peroxisome biogenesis, primarily by:

  • Facilitating the formation and maintenance of ER-peroxisome contact sites

  • Supporting peroxisome proliferation and abundance

  • Influencing the stability and levels of other peroxisomal proteins, particularly Pex11

Studies in Hansenula polymorpha have demonstrated that Pex32 is essential for associating peroxisomes to the ER, with deletion of PEX32 resulting in severe peroxisomal defects . The protein's N-terminal domain, including the four transmembrane helices, is sufficient for its function in peroxisome biogenesis, while the C-terminal DysF domain contributes to concentrating Pex32 at ER-peroxisome contact sites .

How does Pex32 differ across yeast species?

While Pex32 functions are largely conserved across yeast species, notable differences exist in protein localization and interactions. In H. polymorpha, Pex32 localizes predominantly to the ER and is required for forming ER-peroxisome contacts . Comparative studies between H. polymorpha, S. cerevisiae, and S. pombe have revealed variations in how Pex32 and related Pex23 family proteins contribute to peroxisome biogenesis.

In S. pombe specifically, Pex32 (UniProt: O59807) contains distinctive sequence elements compared to its counterparts in other yeasts. These differences may reflect species-specific adaptations in peroxisome biology . Studies have shown that the localization patterns and functional roles of PMPs can vary significantly between yeast species, with some PMPs that end up in mitochondria in the absence of peroxisomes in one species being directed to the ER in another species .

What expression systems are recommended for recombinant Pex32 production?

For recombinant production of S. pombe Pex32, heterologous expression in compatible yeast systems is most commonly employed. When expressing the full-length protein (residues 1-535), considerations should include:

  • Selection of an appropriate promoter system (constitutive vs. inducible)

  • Inclusion of appropriate tags for detection and purification (common tags include GFP and mKate2 for visualization)

  • Buffer optimization containing Tris-based components with 50% glycerol for stability

Commercially available recombinant S. pombe Pex32 is typically supplied in quantities of 50 μg in optimized storage buffers, maintained at -20°C for short-term storage or -80°C for extended storage . For experimental production, GFP or mKate2 fusion constructs have proven effective for localization studies and functional characterization .

How do the transmembrane domains of Pex32 contribute to its localization and function?

The transmembrane domains of Pex32 play distinct roles in protein sorting and function. Through systematic structure-function analysis using truncated variants, researchers have identified that:

  • The second transmembrane (TM) helix contains critical ER targeting information

  • A construct consisting of only TM(I) predominantly localizes to the cytosol

  • All constructs containing TM(II) localize to the ER

  • The complete N-terminus (first 31 residues plus all four TM domains) is both necessary and sufficient for Pex32 function

Experimental approaches have demonstrated that deletion of the first 31 N-terminal residues results in significantly decreased protein levels, suggesting this region contributes to protein stability . Interestingly, localization studies revealed that while the N-terminal domain dictates ER sorting, the C-terminal DysF domain, though redundant for the primary function of Pex32 in peroxisome biogenesis, is capable of associating with peroxisomes and concentrates the protein at ER-peroxisome contact sites .

Pex32 ConstructLocalizationProtein StabilityFunctional Complementation
Full-lengthER (concentrated at contact sites)HighComplete
TM(I-IV)ERHighComplete
TM(I) onlyCytosolReducedNone
TM(II-IV)ERVery lowNone
Constructs with TM(II)ERVariablePartial
Δ31 (lacking first 31 aa)ERStrongly reducedNone
ΔDysFER (diffuse)HighComplete

What experimental approaches are most effective for studying Pex32-dependent ER-peroxisome contact sites?

Investigating Pex32-dependent ER-peroxisome contact sites requires multiple complementary techniques:

  • Fluorescence Microscopy: Dual-labeling approaches using PMP47-mKate2 for peroxisomes combined with Pex32-GFP variants allow visualization of contact sites in living cells . Wide-field microscopy and advanced fluorescence microscopy methods provide superior results compared to early immunofluorescence techniques .

  • Electron Microscopy (EM) and Tomography: These techniques reveal the ultrastructural details of membrane contacts and can distinguish between true contact sites and mere proximity of organelles. EM tomography has been instrumental in establishing that certain membrane structures are not continuous with the ER .

  • Cell Fractionation and Biochemical Analysis: Differential centrifugation combined with western blotting can isolate membrane fractions and detect the presence of marker proteins, helping to establish the biochemical composition of contact sites .

  • Structure-Function Analysis: Creating targeted mutations and truncations of Pex32 domains, followed by functional complementation assays in pex32 deletion strains, reveals which protein regions are essential for contact site formation .

For quantitative assessment, researchers typically grow cells on a mixture of glycerol and methanol to induce peroxisome proliferation, then perform quantitative analysis of fluorescence microscopy images to count peroxisome numbers under different experimental conditions .

What is the relationship between Pex32 and Pex11, and how does it impact peroxisome abundance?

The relationship between Pex32 and Pex11 represents a critical aspect of peroxisome biogenesis regulation:

  • Reduced Pex11 levels in pex32 cells: Western blot analysis reveals that Pex11 levels are strongly reduced in cells lacking Pex32, while other peroxisomal proteins (like AOX, Pex3, and Pex14) remain relatively unaffected .

  • Phenotypic similarity: Both pex32 and pex11 deletion strains exhibit a strong reduction in peroxisome numbers, suggesting a functional relationship .

  • Rescue experiment: Artificial overexpression of PEX11 using the strong AOX promoter in pex32 cells can address whether peroxisome defects are directly linked to reduced Pex11 levels .

The mechanistic connection appears to involve Pex32's role at ER-peroxisome contact sites, which somehow supports Pex11 stability or expression. Importantly, the reduction in peroxisome abundance in pex32 cells is not caused by enhanced autophagy, as demonstrated by experiments with pex32 atg1 double deletion strains .

How can researchers distinguish between direct and indirect effects of Pex32 deletion?

Distinguishing direct from indirect effects of Pex32 deletion requires carefully designed experimental approaches:

  • Complementation studies: Reintroducing different domains of Pex32 can identify which regions directly restore specific functions. Research has shown that the N-terminal domain (including first 31 residues and all four TM helices) is sufficient to restore peroxisome numbers and growth on glycerol/methanol media in pex32 deletion strains .

  • Time-course experiments: Analyzing the temporal sequence of events following controlled Pex32 depletion can help establish causality.

  • Double deletion studies: Creating strains with deletions in both PEX32 and genes involved in potentially related pathways can reveal functional relationships. For example, pex32 atg1 double deletion studies established that reduced peroxisome numbers in pex32 cells are not due to enhanced autophagy .

  • Overexpression studies: Artificially increasing levels of potential downstream effectors (like Pex11) can determine whether they bypass the need for Pex32 .

  • Cross-species complementation: Testing whether Pex32 homologs from different species can rescue defects in S. pombe pex32 mutants helps establish conserved versus species-specific functions.

What are the experimental challenges in purifying functional recombinant Pex32 for in vitro studies?

Purifying functional recombinant Pex32 presents several significant challenges:

  • Membrane protein solubilization: As a multi-pass transmembrane protein, Pex32 requires careful detergent selection for extraction from membranes without disrupting its native conformation.

  • Maintaining stability: Recombinant Pex32 requires optimized buffer conditions (typically Tris-based buffer with 50% glycerol) and storage at -20°C or -80°C . Repeated freeze-thaw cycles should be avoided to prevent denaturation.

  • Functional validation: Confirming that purified Pex32 retains its ability to interact with binding partners requires developing appropriate in vitro assays.

  • Domain-specific considerations: The DysF domain has peroxisome-binding capabilities, while the transmembrane domains have ER-targeting information . Purification strategies may need to account for these distinct functional modules.

  • Protein expression levels: Some Pex32 truncations (particularly those lacking the first 31 N-terminal residues) show significantly reduced expression levels, complicating purification efforts .

For researchers requiring recombinant S. pombe Pex32 for experiments, commercially available products typically provide 50 μg quantities with verified purity and activity .

What genetic approaches are most effective for studying Pex32 function in vivo?

Effective genetic approaches for investigating Pex32 function include:

  • Gene deletion and complementation: Creating pex32 deletion strains followed by reintroduction of wild-type or mutant variants allows detailed structure-function analysis .

  • Domain swapping and truncation: Generating constructs with specific domains deleted or replaced can identify critical functional regions. Studies have shown that the complete N-terminus (first 31 residues plus all four TM domains) is required and sufficient for Pex32 function .

  • Promoter replacement: Placing PEX32 under control of inducible promoters permits temporal control of expression.

  • Fluorescent protein tagging: Fusion of Pex32 variants with fluorescent proteins (GFP, mKate2) enables visualization of subcellular localization and contact site formation .

  • Site-directed mutagenesis: Introducing specific amino acid changes can identify critical residues for function.

For example, introducing constructs containing only portions of Pex32 (such as Pex32TM(I-IV)-GFP) into pex32 deletion strains has revealed that the N-terminal domain is sufficient for restoring peroxisome numbers and growth on glycerol/methanol media .

How should researchers design experiments to analyze Pex32-dependent membrane contacts?

Designing experiments to analyze Pex32-dependent membrane contacts should include:

  • Dual-color fluorescence microscopy: Using differentially labeled markers for the ER and peroxisomes (such as ER markers paired with PMP47-mKate2) allows visualization of contact sites in living cells .

  • Super-resolution microscopy: Techniques like structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) can more precisely define the spatial relationships between organelles.

  • Proximity ligation assays: These can detect proteins that are within 30-40 nm of each other, confirming true membrane contact sites.

  • Domain-specific contributions: Testing constructs like the isolated DysF domain demonstrates its ability to associate with peroxisomes, while constructs lacking this domain show diffuse ER localization rather than concentration at contact sites .

  • Quantitative contact site analysis: Measuring the frequency, size, and duration of contact sites under various conditions provides insights into their regulation.

Growth conditions significantly influence contact site formation, with mixtures of glycerol and methanol often used to induce peroxisome proliferation and enhance the visualization of ER-peroxisome contacts in experimental systems .

What biochemical approaches best characterize Pex32 interactions with other proteins?

Optimal biochemical approaches for characterizing Pex32 protein interactions include:

  • Co-immunoprecipitation: Using antibodies against tagged versions of Pex32 to pull down interaction partners, followed by mass spectrometry or western blotting to identify them.

  • Proximity-based biotinylation: BioID or APEX2 fusion proteins can identify proximal proteins in living cells, which is particularly valuable for mapping the protein landscape at ER-peroxisome contact sites.

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can identify direct protein interactors of specific Pex32 domains.

  • Crosslinking mass spectrometry: This approach can capture transient interactions and provide structural information about interaction interfaces.

  • Western blot analysis: This technique has revealed that Pex11 levels are strongly reduced in pex32 cells, while other peroxisomal proteins remain relatively unaffected, highlighting a specific relationship between these proteins .

When analyzing protein levels in pex32 mutant strains, researchers typically examine peroxisomal matrix proteins like alcohol oxidase (AOX) and PMPs like Pex3 and Pex14 as controls to distinguish specific from general effects on peroxisome biogenesis .

How might Pex32 research inform broader understanding of organelle contact site formation?

Pex32 research provides valuable insights into general principles of organelle contact site formation:

  • Domain specialization: The finding that Pex32's DysF domain specifically contributes to contact site concentration while being dispensable for the protein's primary function suggests functional modularity in contact site proteins .

  • Reciprocal organelle influences: The observation that Pex32 (an ER protein) affects Pex11 levels (a peroxisomal protein) demonstrates how proteins at one organelle can influence the composition and abundance of another organelle .

  • Contact site dynamics: Studies of Pex32 localization reveal that contact sites are not static structures but dynamic entities whose formation depends on specific protein domains and cellular conditions .

  • Evolutionary considerations: The conservation of Pex32-like proteins across diverse fungi suggests fundamental roles in eukaryotic cell biology, while species-specific differences highlight evolutionary adaptations .

This research connects to broader themes in cell biology regarding how membrane-bounded compartments communicate and coordinate functions despite physical separation, with implications for understanding diseases associated with peroxisome dysfunction.

What are the most promising approaches for resolving contradictory findings in Pex32 research?

To resolve contradictions in Pex32 research, researchers should:

What are the current limitations in understanding the three-dimensional structure of Pex32?

Current limitations in understanding Pex32's 3D structure include:

  • Challenges of membrane protein crystallography: As a multi-pass membrane protein, Pex32 presents significant difficulties for traditional structural biology approaches.

  • Domain flexibility: The relationship between Pex32's N-terminal transmembrane region and its C-terminal DysF domain may involve flexible linkers that complicate structural determination.

  • Lack of high-resolution structures: While functional domains have been identified through genetic approaches, high-resolution structural data is limited.

  • Protein-lipid interactions: The membrane environment likely influences Pex32's conformation and function in ways that are difficult to recreate in structural studies.

  • Contact site dynamics: The protein may adopt different conformations when engaged in contact site formation versus when diffusely distributed in the ER membrane.

Approaches to address these limitations might include cryo-electron microscopy of reconstituted systems, molecular dynamics simulations based on homology models, and integrative structural biology approaches combining multiple experimental data types.

What are the most promising future research directions for Pex32 studies?

Promising future research directions include:

  • High-resolution structural studies: Determining the three-dimensional structure of Pex32, particularly at the interface between the ER and peroxisomes.

  • Mechanistic understanding of Pex11 regulation: Elucidating how Pex32 influences Pex11 levels and whether this occurs at the transcriptional, translational, or post-translational level.

  • Temporal dynamics: Investigating how ER-peroxisome contacts mediated by Pex32 change during different cellular states and in response to different metabolic conditions.

  • Comparative studies: Systematic comparison of Pex32 function across diverse fungal species could reveal evolutionary adaptations in peroxisome biogenesis.

  • Interaction networks: Comprehensive mapping of the protein-protein interactions at Pex32-dependent contact sites could reveal additional components and regulatory mechanisms.

These research directions will continue to advance our understanding of how peroxisomes are formed, maintained, and integrated into cellular metabolism, with potential implications for human diseases associated with peroxisome dysfunction.

How might computational approaches enhance our understanding of Pex32 function?

Computational approaches offer powerful tools for advancing Pex32 research:

  • Homology modeling and molecular dynamics: Building structural models based on related proteins and simulating their behavior in membrane environments.

  • Sequence conservation analysis: Identifying highly conserved residues across species that may be functionally critical.

  • Protein-protein interaction prediction: Computational methods can predict potential interaction partners for experimental validation.

  • Systems biology approaches: Integrating Pex32 into broader networks of peroxisome biogenesis factors could reveal emergent properties.

  • Evolutionary analysis: Tracing the evolutionary history of Pex32 and related proteins could provide insights into functional adaptations across different lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.