Recombinant Schizosaccharomyces pombe PGA2-homolog C27.01c (SPBC27.01c)

What is Schizosaccharomyces pombe PGA2-homolog C27.01c and why is it of research interest?

Schizosaccharomyces pombe PGA2-homolog C27.01c (SPBC27.01c) is a protein expressed in fission yeast with UniProt accession number Q9P6S6. It consists of 132 amino acids with a specific sequence profile that suggests functional importance in cellular processes. The protein is of particular research interest because S. pombe serves as an important model organism that is evolutionarily distinct from the more commonly studied Saccharomyces cerevisiae (budding yeast) . Understanding the function of conserved proteins like PGA2-homolog provides insights into fundamental cellular mechanisms that may be shared across eukaryotes, while also highlighting evolutionary divergence in protein function.

How does the amino acid sequence of PGA2-homolog C27.01c inform potential function?

The amino acid sequence of PGA2-homolog C27.01c (MGFDVAGYLQSYSLKDWIRIIVYVGGYMLIRRYLMKLGAKIQEREHRKSLLEGE VDGTLDPEMTHGTKPKEHGEFDTDDEEEEENPDAEFRWGYSARRRIRKQREEYFKNQDKSPLDAYADDDEDIEEHLED) reveals several structural and functional features . Analysis shows:

• A relatively high proportion of charged residues (E, D, K, R) in the C-terminal region, suggesting potential for protein-protein interactions

• Conserved hydrophobic regions that may indicate membrane association

• Multiple phosphorylation sites (S/T residues) suggesting regulation by kinases

• The presence of a YGG motif that appears in some RNA-binding proteins

Experimental characterization through domain swapping, site-directed mutagenesis of conserved residues, and structural studies would be necessary to definitively link sequence features to specific functions.

What optimal conditions should be considered for recombinant expression of S. pombe PGA2-homolog C27.01c in E. coli?

Based on experimental design approaches for recombinant protein expression, the following conditions should be systematically evaluated for optimal expression of S. pombe PGA2-homolog C27.01c:

A factorial experimental design approach (similar to the 2^n-4 factorial design described for pneumolysin) would allow systematic evaluation of these parameters to identify optimal conditions for soluble expression . The goal should be to balance high protein yield with proper folding to maintain native structure and function.

What expression vector and tag systems are most appropriate for functional studies of PGA2-homolog C27.01c?

When designing an expression system for functional studies of PGA2-homolog C27.01c, consider:

• Vector selection: pET series vectors provide tight regulation and high-level expression under T7 promoter control, while pBAD vectors offer more tunable expression through arabinose induction.

• Tag selection and positioning:

  • His6 tags facilitate purification but may affect function if placed at functionally important termini

  • GST or MBP tags can enhance solubility but may mask native protein interactions

  • Smaller tags like FLAG or Strep-II minimally impact structure but provide less solubility enhancement

• Tag removal strategy:

  • Include precision protease cleavage sites (TEV, PreScission, or thrombin) between the tag and protein

  • Validate that tag removal doesn't affect protein stability or function

• Inducible promoter system:

  • IPTG-inducible systems provide good control but may lead to leaky expression

  • Tetracycline-regulated systems offer tighter control for potentially toxic proteins

The final selection should prioritize maintaining the protein's native conformation while enabling efficient purification and functional characterization.

How can researchers determine the subcellular localization of PGA2-homolog C27.01c in S. pombe?

To determine the subcellular localization of PGA2-homolog C27.01c, researchers should employ multiple complementary approaches:

• Fluorescent protein tagging:

  • Create C- and N-terminal GFP fusions with PGA2-homolog while verifying functionality

  • Visualize localization in live cells using confocal microscopy

  • Combine with organelle-specific markers to confirm colocalization

• Immunofluorescence microscopy:

  • Generate specific antibodies against PGA2-homolog or use epitope tagging

  • Fix and permeabilize cells using methods optimized for S. pombe

  • Perform co-staining with organelle markers

• Subcellular fractionation:

  • Fractionate S. pombe cells into cytosolic, nuclear, membrane, and organelle fractions

  • Analyze fractions by Western blotting to track PGA2-homolog distribution

  • Include controls for each cellular compartment (e.g., tubulin for cytosol, histone for nucleus)

• Heterologous expression analysis:

  • Express in budding yeast and compare localization patterns to infer conservation of targeting signals

Inconsistencies between methods should be investigated, as they may reveal dynamic localization patterns or technical artifacts. Comparing results under different growth conditions and cell cycle stages is important for comprehensive characterization.

What approaches can be used to identify protein interaction partners of PGA2-homolog C27.01c?

To identify protein interaction partners of PGA2-homolog C27.01c, employ a multi-faceted approach:

• Affinity purification coupled with mass spectrometry (AP-MS):

  • Express tagged PGA2-homolog C27.01c in S. pombe

  • Optimize lysis conditions to preserve native interactions

  • Purify protein complexes using tag-specific affinity matrices

  • Identify co-purifying proteins by mass spectrometry

  • Validate with reciprocal tagging of identified partners

• Yeast two-hybrid (Y2H) screening:

  • Use PGA2-homolog as bait against S. pombe cDNA library

  • Consider both N- and C-terminal fusions to DNA-binding domain

  • Validate positive interactions by co-immunoprecipitation

• Proximity-based labeling:

  • Generate BioID or TurboID fusions with PGA2-homolog

  • Express in S. pombe to biotinylate proximal proteins

  • Purify biotinylated proteins and identify by mass spectrometry

• Genetic interaction screening:

  • Perform synthetic genetic array (SGA) analysis with PGA2-homolog deletion

  • Identify genes showing synthetic lethality or rescue

  • Correlate genetic interactions with physical interaction data

• Crosslinking mass spectrometry:

  • Use chemical crosslinking to capture transient interactions

  • Identify crosslinked peptides to map interaction interfaces

Compare results from multiple methods to build a high-confidence interaction network. Consider examining interactions in different cellular contexts, such as during DNA replication or under stress conditions, as S. pombe proteins often have context-dependent interaction patterns .

How conserved is PGA2-homolog C27.01c across fungal species and what does this reveal about its function?

The evolutionary conservation pattern of PGA2-homolog C27.01c provides valuable insights into its functional importance:

• Conservation analysis across yeasts:

  • Despite the immense evolutionary divergence between S. pombe and S. cerevisiae , certain protein domains may show conservation

  • Similar to the observation with php2 (S. pombe HAP2 homolog), PGA2-homolog likely contains small conserved functional domains within a largely divergent protein structure

  • Identify these conserved regions through multiple sequence alignments

• Functional implications of conservation patterns:

  • Highly conserved domains typically represent functional cores essential for activity

  • Variable regions often mediate species-specific regulation or interactions

  • Compare conservation patterns with known domain structures of related proteins

• Methodological approach for comprehensive analysis:

  • Perform BLAST searches against fungal genomes with varying evolutionary distances

  • Conduct position-specific scoring matrix (PSSM) searches to identify distant homologs

  • Create phylogenetic trees to visualize evolutionary relationships

  • Map conservation scores onto structural models or predictions

• Correlation with experimental data:

  • Test whether disruption of conserved regions affects protein function more severely than disruption of variable regions

  • Compare phenotypes of gene deletions across species where homologs exist

Like the HAP2 homolog in S. pombe (php2), which maintains only 82% identity in a small 60-amino-acid core region while the remainder of the protein diverges completely , PGA2-homolog may represent another example where a small functional domain is preserved within an otherwise rapidly evolving protein sequence.

How does the function of PGA2-homolog C27.01c in S. pombe compare to its homologs in other organisms?

The functional comparison of PGA2-homolog C27.01c across species requires systematic analysis:

• Functional conservation assessment:

  • Determine if PGA2-homolog C27.01c can complement deletion of homologous genes in other yeasts

  • Test whether homologs from other species can rescue PGA2-homolog C27.01c deletion phenotypes in S. pombe

  • This approach revealed that S. pombe php2 could functionally complement S. cerevisiae hap2, demonstrating conservation of core function despite sequence divergence

• Comparative phenotypic analysis:

  • Compare deletion phenotypes across species where homologs exist

  • Analyze under various conditions to identify context-dependent functions

  • S. pombe and S. cerevisiae HAP homologs both affect mitochondrial function, suggesting conservation of this role despite divergence

• Protein interaction network comparison:

  • Compare interaction partners of homologs across species

  • Identify conserved and species-specific interactions

  • Analyze how interaction networks have evolved in relation to sequence changes

• Expression pattern comparisons:

  • Analyze expression data across species to identify conserved regulation

  • Determine if homologs respond similarly to environmental conditions

• Domain function analysis:

  • Create chimeric proteins by swapping domains between homologs

  • Test functionality of chimeras to map functionally equivalent regions

This comparative approach can reveal how PGA2-homolog functions have evolved and may identify species-specific adaptations versus core conserved functions, similar to the insights gained from studying HAP complex homologs across yeasts and mammals .

How might PGA2-homolog C27.01c be involved in DNA replication and repair mechanisms in S. pombe?

The potential involvement of PGA2-homolog C27.01c in DNA replication and repair can be investigated through multiple approaches:

• Genetic interaction screening:

  • Test for synthetic lethality or sickness when PGA2-homolog C27.01c mutations are combined with known replication and repair gene mutations

  • Analyze genetic relationships with the replication fork barrier components mentioned in S. pombe literature

• Analysis during replication stress:

  • Examine protein localization during normal replication versus replication stress

  • Test sensitivity of PGA2-homolog C27.01c mutants to replication inhibitors like hydroxyurea or MMS

  • Compare with known replication and recombination factors in S. pombe

• Chromatin association studies:

  • Perform ChIP-seq to determine if PGA2-homolog C27.01c associates with specific genomic regions

  • Test association with replication origins, fork barriers, or sites of recombination

  • S. pombe shows distinct patterns of DNA breakage during meiosis at specific chromosomal sites , so examining potential relationships with these sites could be informative

• Role in recombination:

  • Test involvement in the distinct recombination mechanisms documented in S. pombe

  • S. pombe exhibits both DSB-dependent and DSB-independent recombination mechanisms , so examining PGA2-homolog's role in each pathway would be valuable

  • Analyze phenotypes related to fork reversal and semi-conservative replication during DNA damage bypass

Given that S. pombe employs distinctive mechanisms for handling replication stress and DNA damage compared to S. cerevisiae , characterizing PGA2-homolog C27.01c's potential role in these processes could reveal species-specific adaptations in DNA metabolism pathways.

How can CRISPR-Cas9 genome editing be optimized for functional studies of PGA2-homolog C27.01c in S. pombe?

Optimizing CRISPR-Cas9 genome editing for S. pombe PGA2-homolog C27.01c studies requires addressing several key challenges:

• Guide RNA design considerations:

  • Select sgRNAs with minimal off-target potential across the S. pombe genome

  • Design multiple sgRNAs targeting different regions of PGA2-homolog C27.01c

  • Consider S. pombe-specific factors influencing gRNA efficiency (GC content, secondary structure)

  • Test activity using reporter systems before proceeding to genomic editing

• Cas9 expression optimization:

  • Use codon-optimized Cas9 for S. pombe

  • Select appropriate promoters (e.g., nmt1 or derivatives) for controlled expression

  • Consider using a Cas9 fused to a nuclear localization signal optimized for S. pombe

• Delivery and selection strategies:

  • Develop transformation protocols optimized for S. pombe

  • Use appropriate selection markers compatible with the genetic background

  • Consider transient Cas9 expression to minimize off-target effects

• Repair template design for precise editing:

  • Include at least 500 bp homology arms for efficient homologous recombination

  • Introduce silent mutations at the PAM site to prevent re-cutting after editing

  • Design epitope tags that minimize disruption of protein function

  • For domain analysis, design truncations based on predicted structural boundaries

• Validation and quality control:

  • Sequence the entire edited locus to confirm precise editing

  • Verify expression levels of modified protein are comparable to wild-type

  • Test functionality through complementation assays

  • Screen multiple clones to identify potential off-target effects

This optimized CRISPR-Cas9 approach allows for sophisticated genetic manipulations, including precise point mutations to test the functional significance of conserved residues, domain deletions to map functional regions, and N- or C-terminal tagging for localization and interaction studies.

What strategies can address solubility challenges when expressing recombinant PGA2-homolog C27.01c protein?

Addressing solubility challenges for PGA2-homolog C27.01c requires a systematic approach:

• Expression condition optimization:

  • Apply factorial design methodology as demonstrated for pneumolysin expression

  • Systematically vary temperature (16-30°C), inducer concentration (0.01-1.0 mM IPTG), and induction time (2-16 hours)

  • The optimized conditions for pneumolysin (25°C, 0.1 mM IPTG, 4 hours) provide a starting point

  • Consider specialized media formulations with osmolytes or chaperone inducers

• Fusion partner strategies:

  • Test multiple solubility-enhancing fusion partners:

    • MBP (maltose-binding protein) - highly effective for enhancing solubility

    • SUMO - promotes proper folding

    • Thioredoxin - enhances disulfide bond formation

    • NusA - slows translation to facilitate folding

  • Compare N-terminal versus C-terminal fusion positions

• Co-expression approaches:

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J, trigger factor)

  • Co-express with binding partners if known

  • Design bicistronic constructs for stoichiometric expression of interacting partners

• Refolding strategies:

  • If inclusion bodies form, develop a refolding protocol:

    • Solubilize in 8M urea or 6M guanidine HCl

    • Remove denaturant by dialysis or dilution

    • Add redox couples (GSH/GSSG) if disulfide bonds are present

    • Include stabilizing additives (arginine, glycerol, sucrose)

• Rational design approaches:

  • Perform computational analysis to identify aggregation-prone regions

  • Design surface-exposed mutations to enhance solubility

  • Remove hydrophobic patches through targeted mutagenesis

  • Consider truncated constructs based on domain predictions

By employing these strategies systematically and quantitatively assessing protein solubility and activity after each intervention, researchers can develop an optimized protocol for obtaining functional PGA2-homolog C27.01c protein for structural and biochemical studies.

How can researchers differentiate between direct and indirect effects when analyzing phenotypes of PGA2-homolog C27.01c mutants?

Differentiating between direct and indirect effects in PGA2-homolog C27.01c mutant phenotypes requires multiple complementary approaches:

• Temporal analysis of phenotypic manifestation:

  • Employ rapid inactivation systems like auxin-inducible degrons or temperature-sensitive alleles

  • Monitor how quickly phenotypes appear after protein inactivation

  • Primary effects typically manifest rapidly (minutes to hours) while secondary effects develop more slowly

  • Use time-course experiments to establish cause-effect relationships

• Separation-of-function mutations:

  • Generate a panel of point mutations or domain deletions

  • Characterize which mutations affect specific functions versus those causing global defects

  • Map mutations to protein interaction interfaces using structural information

  • Correlate phenotypic severity with biochemical defects in specific activities

• Suppressor screening:

  • Identify genetic suppressors of PGA2-homolog C27.01c mutant phenotypes

  • Characterize whether suppressors act by bypassing, compensating, or directly reversing the primary defect

  • Perform epistasis analysis with suppressors to position PGA2-homolog in genetic pathways

• Molecular bypass experiments:

  • Artificially tether interaction partners that may be brought together by PGA2-homolog

  • Express fusion proteins that might bypass the need for PGA2-homolog in specific processes

  • Test if artificial recruitment of potential downstream factors can rescue specific phenotypes

• Multi-omics analysis:

  • Perform time-resolved transcriptomics, proteomics, and metabolomics after PGA2-homolog inactivation

  • Distinguish primary responses (rapid changes in few pathways) from secondary adaptations (delayed, broad changes)

  • Integrate with known regulatory networks to identify direct regulatory targets

This multi-faceted approach allows researchers to build a hierarchical model of PGA2-homolog C27.01c function, distinguishing its immediate molecular functions from downstream consequences and cellular adaptations to its loss.

How can researchers integrate PGA2-homolog C27.01c functional data with broader cellular pathway analysis in S. pombe?

Integrating PGA2-homolog C27.01c functional data into cellular pathway contexts requires comprehensive data integration strategies:

• Network integration approaches:

  • Construct protein interaction networks around PGA2-homolog C27.01c

  • Overlay genetic interaction data to identify functional relationships

  • Map onto known S. pombe cellular pathways

  • Compare with analogous networks in other yeasts to identify conserved modules

• Multi-omics data integration:

  • Combine proteomics, transcriptomics, and metabolomics data

  • Use supervised and unsupervised machine learning to identify patterns and correlations

  • Perform enrichment analysis for biological processes and molecular functions

  • Develop predictive models for PGA2-homolog function based on integrated datasets

• Comparative analysis across stress conditions:

  • Analyze behavior of PGA2-homolog mutants under different stresses

  • Identify condition-specific interactions and dependencies

  • Compare with genome-wide stress response data in S. pombe

  • This approach has been valuable for characterizing replication and recombination factors in S. pombe

• Pathway reconstruction and validation:

  • Propose mechanistic models based on integrated data

  • Test predictions with targeted experiments

  • Refine models iteratively based on new data

  • Validate across different genetic backgrounds and conditions

• Visualization and analysis tools:

  • Develop custom visualization pipelines for complex relationships

  • Use existing tools like Cytoscape with PomBase data integration

  • Create interactive models that incorporate temporal and spatial dynamics

Through systematic data integration, researchers can position PGA2-homolog C27.01c within the broader cellular context of S. pombe biology, potentially revealing unexpected connections to cellular processes beyond its immediately obvious functions.

What computational approaches best predict the structural features and functional domains of PGA2-homolog C27.01c?

Predicting structural features and functional domains of PGA2-homolog C27.01c requires multiple computational approaches:

• Sequence-based domain prediction:

  • Apply multiple tools (InterProScan, SMART, Pfam) to identify conserved domains

  • Use disorder prediction algorithms to identify structured vs. unstructured regions

  • Analyze sequence composition for features like low-complexity regions, coiled-coils, or transmembrane segments

  • Predict post-translational modification sites using specialized tools

• Structural modeling approaches:

  • Perform template-based modeling if homologous structures exist

  • Use AlphaFold2 or RoseTTAFold for ab initio structure prediction

  • Validate models using quality assessment tools (MolProbity, QMEAN)

  • Refine models through molecular dynamics simulations

  • Compare predictions from multiple methods to identify high-confidence structural elements

• Functional site prediction:

  • Identify potential ligand-binding pockets using cavity detection algorithms

  • Predict DNA/RNA binding regions using electrostatic surface analysis

  • Map conservation scores onto structural models to identify functional hotspots

  • Use molecular docking to test potential interactions with biomolecules

• Evolutionary coupling analysis:

  • Apply direct coupling analysis to detect co-evolving residues

  • Use evolutionary constraints to validate and refine structural models

  • Identify potential allosteric networks within the protein structure

• Integration with experimental data:

  • Map available mutagenesis data onto structural models

  • Correlate predicted functional sites with phenotypic data

  • Design experiments to validate computational predictions

This comprehensive computational approach provides testable hypotheses about PGA2-homolog C27.01c structure and function that can guide targeted experimental investigations, similar to approaches that have been successful in characterizing other S. pombe proteins with limited direct structural information.