Recombinant Schizosaccharomyces pombe Phosphatidylglycerol phospholipase C (SPAC4D7.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SPAC4D7.02c; Phosphatidylglycerol phospholipase C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC4D7.02c
Target Protein Sequence
MAFNYSIANTVDDAAQSIAENTSSLATFSKPPLVIAHRGYKAKYPENTILAFQQAVKAGA DCVETDVRLTKDEVVCILHDRNLNRVFGVDVDVRDLDYELDNGHFRTIQEPHEPLPTYEQ FLHELTKHPGVNLLVDIKPVNDLLIIPRMVDAMLRVNSDLDFWKDKVSFCLWSHRFIPAC DRYAPSIPLYHIGFNFAYAERHFVMHPRVKGVSMAVALFLLPHSQDFVDLVHAQGKQVFA WTLNTPSSIYLALIRGCDGLLSDDPVMARALSQGPIVTKSWHYFHYSEWLHMIYGFLRAQ FVFFLLRTFVL
Uniprot No.

Target Background

Function

Phosphatidylglycerol phospholipase C (PGPLase C) is an enzyme essential for removing excess phosphatidylglycerol (PG) through a phospholipase C-type degradation mechanism.

Database Links
Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Mitochondrion membrane; Single-pass type IV membrane protein. Lipid droplet.

Q&A

What is SPAC4D7.02c and what is its functional role in Schizosaccharomyces pombe?

SPAC4D7.02c is a gene that encodes Phosphatidylglycerol phospholipase C in the fission yeast Schizosaccharomyces pombe. The protein is 311 amino acids in length and plays a role in phospholipid metabolism . While annotated as a phosphatidylglycerol phospholipase C, it has also been described as a glycerophosphoryl diester phosphodiesterase in some databases . The enzyme is involved in membrane phospholipid turnover, specifically catalyzing the hydrolysis of phosphatidylglycerol.

Unlike higher eukaryotes, S. pombe notably lacks endogenous receptor tyrosine kinases and their associated signaling apparatus, making it a valuable model system for reconstitution studies of mammalian signaling pathways, including those involving phospholipases . This characteristic allows researchers to study isolated phospholipase activity without interference from endogenous signaling systems.

What are the optimal expression and purification strategies for recombinant SPAC4D7.02c?

For optimal expression of SPAC4D7.02c, E. coli is the preferred heterologous host system due to its simplicity and high yield potential . The expression construct should include an N-terminal His-tag for affinity purification. IPTG induction at mid-log phase (OD600 of 0.6-0.8) at a reduced temperature (16-18°C) often improves soluble protein yield by slowing the rate of protein synthesis and folding.

The purification process typically involves:

  • Cell lysis under native conditions using buffer containing mild detergents

  • Clarification of lysate by centrifugation at high speed (20,000 × g for 30 minutes)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing with increasing imidazole concentrations to remove non-specific binding

  • Elution with high imidazole concentration (250-300 mM)

  • Size exclusion chromatography for further purification and buffer exchange

For researchers investigating phospholipase activity, it's crucial to remove imidazole post-purification as it may interfere with activity assays. Dialysis or buffer exchange using desalting columns into a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose helps maintain protein stability .

How should recombinant SPAC4D7.02c be stored to maintain stability and activity?

Optimizing storage conditions is critical for maintaining the stability and enzymatic activity of recombinant SPAC4D7.02c. The recommended storage protocol includes:

  • Aliquoting the purified protein to avoid repeated freeze-thaw cycles

  • Adding glycerol to a final concentration of 20-50% for cryoprotection

  • Flash-freezing in liquid nitrogen for long-term storage

  • Storing at -80°C for extended periods or -20°C for medium-term storage

For working stocks, storage at 4°C is suitable for up to one week . The protein should be maintained in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose as a stabilizing agent. This combination helps preserve the native conformation of the protein and prevents aggregation .

It's important to note that repeated freeze-thaw cycles significantly reduce activity, so multiple small aliquots are preferable to a single large stock. Additionally, the presence of reducing agents like DTT or β-mercaptoethanol (1-5 mM) may help prevent oxidation of cysteine residues.

How can SPAC4D7.02c be used in reconstitution studies of phospholipase signaling pathways?

SPAC4D7.02c can serve as an excellent tool for reconstitution studies due to S. pombe's lack of endogenous receptor tyrosine kinases and associated signaling machinery . This characteristic makes it an ideal system for studying isolated phospholipase activity without interference from endogenous pathways.

A methodological approach for reconstitution studies involves:

  • Co-expression of SPAC4D7.02c with mammalian signaling components in S. pombe

  • Analysis of phospholipase activation through measurement of hydrolysis products

  • Investigation of regulatory mechanisms by introducing mutations in potential phosphorylation sites

For example, researchers have successfully reconstituted mammalian platelet-derived growth factor beta (PDGF β) receptor-linked activation of phospholipase C gamma 2 (PLC γ2) in S. pombe . When co-expressed, both PDGF β receptor and PLC γ2 undergo tyrosine phosphorylation, resulting in a greater than 26-fold increase in inositol phosphate production . Similar approaches can be applied to study SPAC4D7.02c regulation.

This reconstitution system allows for detailed dissection of:

  • Protein-protein interactions in signaling cascades

  • Regulatory mechanisms controlling enzyme activation

  • Effects of inhibitors or activators on pathway components

What experimental methods are recommended for measuring SPAC4D7.02c enzymatic activity?

Measuring the enzymatic activity of SPAC4D7.02c requires quantitative assessment of its ability to hydrolyze phosphatidylglycerol. Several approaches can be employed:

  • Radiometric assays: Using radiolabeled substrates such as [³H]-phosphatidylglycerol to measure product formation through scintillation counting. This highly sensitive method can detect even low levels of enzymatic activity.

  • Colorimetric assays: Utilizing coupled enzyme systems where the released phosphate is detected through color development. While less sensitive than radiometric methods, these assays are more accessible for routine screening.

  • Fluorescence-based assays: Employing fluorescently labeled phospholipid substrates to monitor hydrolysis in real-time through changes in fluorescence properties.

  • Mass spectrometry: LC-MS/MS analysis of reaction products provides detailed characterization of substrate specificity and reaction kinetics.

A standardized activity assay protocol might include:

ComponentConcentration
Recombinant SPAC4D7.02c0.1-1.0 μg/mL
Phosphatidylglycerol100-200 μM
Buffer50 mM Tris-HCl, pH 7.5
NaCl150 mM
CaCl₂2 mM
Temperature30°C (optimal for S. pombe enzymes)
Incubation time15-60 minutes

When analyzing activity data, it's important to consider that phospholipases can exhibit interfacial activation, where activity depends on the presentation of the substrate (micelles, vesicles, or mixed micelles with detergents). Experimental conditions should be carefully optimized and standardized to ensure reproducibility.

How do experimental conditions affect SPAC4D7.02c activity compared to phospholipases from other organisms?

When comparing SPAC4D7.02c activity with phospholipases from other organisms, several key experimental parameters must be considered:

  • pH optimum: While phospholipase B from S. pombe shows optimal activity at pH 2.5 with no detectable activity at neutral or alkaline pH , SPAC4D7.02c likely has different pH requirements that should be systematically evaluated.

  • Divalent cation requirements: Many phospholipases require calcium or other divalent cations for activity. For instance, PLC γ2 in S. pombe is sensitive to calcium activation . The specific cation requirements for SPAC4D7.02c should be determined through activity assays with various divalent ions (Ca²⁺, Mg²⁺, Mn²⁺, etc.).

  • Substrate specificity: Unlike phospholipase B from S. pombe, which can hydrolyze various phospholipids with preference for phosphatidylinositol , SPAC4D7.02c may have distinct substrate preferences that should be characterized using a panel of phospholipid substrates.

  • Detergent sensitivity: Activity may be modulated by detergents. For example, S. pombe phospholipase B is slightly stimulated by 0.1% sodium deoxycholate but inhibited by 0.1% sodium dodecyl sulfate . Similar characterization should be performed for SPAC4D7.02c.

  • Temperature stability: Unlike the heat-sensitive phospholipase B from S. pombe , SPAC4D7.02c may have different temperature stability profiles that should be determined through thermal inactivation studies.

A comprehensive comparative analysis requires systematic evaluation of these parameters across enzymes from different sources under standardized conditions.

What are effective approaches for studying SPAC4D7.02c structure-function relationships?

Investigating structure-function relationships in SPAC4D7.02c can be accomplished through several complementary approaches:

  • Site-directed mutagenesis: Targeting conserved residues predicted to be involved in catalysis or substrate binding. Key residues can be identified through sequence alignment with well-characterized phospholipases or structural modeling.

  • Domain swap experiments: Creating chimeric proteins by exchanging domains between SPAC4D7.02c and other phospholipases to identify regions responsible for specific functional properties.

  • Limited proteolysis: Identifying stable structural domains and flexible regions by subjecting the purified protein to controlled proteolytic digestion followed by mass spectrometry analysis.

  • Crystallography or cryo-EM: Determining the three-dimensional structure to provide atomic-level insights into catalytic mechanisms and substrate interactions. Protein engineering may be required to improve crystallization properties.

  • Molecular dynamics simulations: Using computational approaches to model protein dynamics, substrate binding, and catalytic mechanisms based on structural data.

A systematic mutational analysis might focus on:

Mutation TargetRationaleExpected Outcome
Catalytic residuesDirect involvement in catalysisComplete loss of activity
Substrate-binding residuesMediate substrate recognitionAltered substrate specificity
Regulatory regionsControl access to active siteConstitutive activation or inactivation
Post-translational modification sitesModulate enzyme regulationAltered regulatory responses

For expression and functional characterization of mutants, an experimental design following standard scientific protocols should be employed . This includes appropriate controls, statistical analysis, and consideration of variables that might affect outcomes.

How can SPAC4D7.02c be utilized in membrane interaction studies?

Understanding how SPAC4D7.02c interacts with cellular membranes is crucial for elucidating its biological function. Several techniques can be employed to study these interactions:

  • Liposome binding assays: Preparing artificial membranes with defined phospholipid compositions and measuring protein binding through co-sedimentation, fluorescence, or surface plasmon resonance.

  • Monolayer penetration experiments: Assessing the ability of SPAC4D7.02c to penetrate phospholipid monolayers of varying surface pressures, providing insights into membrane insertion mechanisms.

  • Fluorescence techniques: Using intrinsic tryptophan fluorescence or extrinsic fluorescent probes to monitor conformational changes upon membrane binding.

  • Atomic force microscopy (AFM): Visualizing protein-membrane interactions at the nanoscale to understand topographical changes in membrane structure.

  • Vesicle leakage assays: Evaluating whether SPAC4D7.02c induces membrane permeabilization through the release of fluorescent markers from liposomes.

For in vivo studies, fluorescently tagged SPAC4D7.02c can be expressed in S. pombe to monitor its localization and dynamics. This approach can be complemented with immunogold electron microscopy for higher-resolution localization studies, similar to techniques used for other S. pombe proteins .

Understanding these interactions is particularly important since S. pombe has been used as a model system for reconstituting mammalian signaling pathways involving phospholipases, where proper membrane localization is crucial for function .

What are the common challenges in expressing and purifying active SPAC4D7.02c?

Researchers frequently encounter several challenges when working with recombinant SPAC4D7.02c:

  • Inclusion body formation: The protein may form insoluble aggregates during expression in E. coli. This can be addressed by:

    • Lowering expression temperature to 16-18°C

    • Using specialized E. coli strains designed for membrane or difficult proteins

    • Co-expressing with molecular chaperones

    • Adding solubility-enhancing fusion tags (SUMO, MBP, etc.)

  • Proteolytic degradation: To minimize degradation during purification:

    • Include protease inhibitor cocktails in all buffers

    • Work at 4°C throughout the purification process

    • Use freshly prepared buffers with reducing agents

    • Consider adding stabilizing agents like glycerol or trehalose

  • Loss of activity during purification: Enzymatic activity may be compromised by:

    • Exposure to harsh elution conditions

    • Removal of essential co-factors or metal ions

    • Oxidation of critical cysteine residues

    • Improper protein folding

A systematic optimization approach might include:

ParameterOptimization StrategyEvaluation Method
Expression temperatureTest range from 16-37°CSDS-PAGE of soluble fraction
Induction time3, 6, 18, 24 hoursActivity assay and yield measurement
Lysis buffer compositionTest different detergents and salt concentrationsRecovery of active protein
Purification methodCompare IMAC, ion exchange, and affinity chromatographyPurity and specific activity

If encountering persistent issues with activity loss, consider expressing the protein in yeast expression systems that may provide more appropriate post-translational modifications and folding environment.

How can researchers troubleshoot inconsistent enzymatic activity of SPAC4D7.02c?

Inconsistent enzymatic activity is a common challenge in phospholipase research. Systematic troubleshooting should address:

  • Protein quality: Verify integrity through:

    • SDS-PAGE analysis to confirm absence of degradation

    • Mass spectrometry to confirm correct sequence

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to detect aggregation

  • Substrate preparation: Phospholipid substrates can form various physical states (micelles, vesicles) that affect enzyme accessibility:

    • Ensure consistent substrate preparation methods

    • Verify substrate quality through thin-layer chromatography

    • Consider the physical presentation of substrates (detergent-mixed micelles vs. liposomes)

  • Assay conditions: Systematically optimize:

    • Buffer composition and pH

    • Ionic strength

    • Divalent cation concentration

    • Temperature

    • Incubation time

  • Storage effects: Even with recommended storage in Tris/PBS-based buffer with 6% trehalose :

    • Monitor activity retention over time

    • Limit freeze-thaw cycles

    • Consider adding stabilizing agents like glycerol

An effective approach is to prepare a large batch of enzyme, divide into single-use aliquots, and use one reference aliquot to normalize activity across experiments. This helps distinguish between true experimental variations and differences in enzyme preparation.

What are the best practices for designing experiments to study SPAC4D7.02c regulation?

Designing robust experiments to study SPAC4D7.02c regulation requires careful consideration of multiple factors:

  • Establish baseline activity: Thoroughly characterize the enzyme's basic properties (pH optimum, cation requirements, kinetic parameters) before investigating regulatory mechanisms.

  • Control for interfering factors: When studying potential regulators:

    • Ensure regulators don't directly affect assay components

    • Include appropriate negative controls

    • Consider dose-response relationships

    • Verify specificity with structurally related but inactive analogs

  • Leverage S. pombe as a model system: Utilize the unique advantages of S. pombe for in vivo studies:

    • Lack of endogenous receptor tyrosine kinase signaling provides a clean background

    • Genetic manipulation through homologous recombination allows for precise genome editing

    • Expression of mammalian regulatory components can reconstitute signaling pathways

  • Consider phosphorylation regulation: Based on findings with PLC γ2 in S. pombe :

    • Investigate tyrosine phosphorylation as a potential regulatory mechanism

    • Test effects of phosphatase inhibitors like pervanadate

    • Create phosphomimetic mutants to study constitutive activation

  • Follow sound experimental design principles:

    • Define clear hypotheses and specific objectives

    • Include appropriate controls for each variable

    • Use randomization and blinding where applicable

    • Ensure adequate statistical power through proper sample sizing

For studying protein-protein interactions that might regulate SPAC4D7.02c, consider techniques like co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling approaches.

How can SPAC4D7.02c be utilized as a tool for membrane lipid research?

SPAC4D7.02c offers several advantages as a tool for membrane lipid research:

  • Phospholipid remodeling: The enzyme can be used to specifically modify membrane composition in vitro or in vivo by selectively hydrolyzing phosphatidylglycerol. This allows researchers to:

    • Study the effects of altered phospholipid composition on membrane properties

    • Investigate the consequences of phosphatidylglycerol depletion on cellular functions

    • Generate specific lipid species for further analysis

  • Lipid domain studies: By targeting specific phospholipids, SPAC4D7.02c can help investigate:

    • The role of phosphatidylglycerol in membrane microdomain formation

    • Interactions between phospholipids and membrane proteins

    • Membrane fluidity and phase separation in artificial and biological membranes

  • Analytical applications: The enzyme can serve as a specific reagent for:

    • Quantitative determination of phosphatidylglycerol content in complex lipid mixtures

    • Structural analysis of phosphatidylglycerol species through selective hydrolysis

    • Preparation of standardized lipid mixtures for lipidomic studies

  • Comparative studies: Using SPAC4D7.02c alongside other phospholipases enables:

    • Differential analysis of phospholipid classes in complex membranes

    • Investigation of phospholipid-specific signaling pathways

    • Understanding the evolutionary conservation of lipid metabolism mechanisms

For these applications, it's essential to thoroughly characterize the substrate specificity and activity parameters of the enzyme, as different experimental conditions may significantly affect its performance.

What insights can SPAC4D7.02c provide into the evolution of phospholipase signaling systems?

SPAC4D7.02c offers a unique evolutionary perspective on phospholipase signaling systems:

  • Comparative genomics: Analysis of SPAC4D7.02c in relation to phospholipases from other organisms can reveal:

    • Conserved catalytic mechanisms across species

    • Lineage-specific adaptations in substrate recognition

    • Evolution of regulatory mechanisms

  • Simplified signaling context: S. pombe lacks endogenous receptor tyrosine kinases and associated signaling apparatus , providing an opportunity to:

    • Study phospholipase function in isolation from complex regulatory networks

    • Identify the minimal requirements for phospholipase activation

    • Trace the evolutionary acquisition of regulatory mechanisms

  • Reconstitution studies: By expressing SPAC4D7.02c with components from other organisms, researchers can:

    • Investigate compatibility between evolutionarily distant signaling elements

    • Identify key adaptations required for functional integration

    • Reconstruct potential evolutionary intermediates in signaling pathways

  • Structural insights: Comparing the structure of SPAC4D7.02c with mammalian phospholipases can reveal:

    • Conservation of catalytic domains

    • Emergence of regulatory domains

    • Adaptations in membrane interaction surfaces

This evolutionary perspective is particularly valuable given that S. pombe has been successfully used to reconstitute mammalian phospholipase signaling pathways, as demonstrated with PLC γ2 activation by the PDGF β receptor . Such studies highlight the remarkable conservation of core enzymatic mechanisms despite significant divergence in regulatory systems.

How can advanced imaging techniques be applied to study SPAC4D7.02c localization and dynamics?

Advanced imaging techniques provide powerful tools for visualizing SPAC4D7.02c localization and dynamics in living cells:

  • Fluorescent protein tagging: Generating SPAC4D7.02c fusions with fluorescent proteins allows:

    • Real-time monitoring of localization in living cells

    • Analysis of protein dynamics through techniques like FRAP (Fluorescence Recovery After Photobleaching)

    • Observation of redistribution in response to cellular stimuli

  • Super-resolution microscopy: Techniques like STED, PALM, or STORM enable:

    • Visualization of SPAC4D7.02c association with specific membrane domains

    • Colocalization studies with other proteins at nanometer resolution

    • Detailed mapping of enzyme distribution relative to cellular structures

  • Multi-color imaging: Combining SPAC4D7.02c labeling with markers for cellular organelles:

    • Determines the precise subcellular localization

    • Reveals dynamic trafficking between compartments

    • Identifies potential sites of action

  • FRET-based sensors: Designing biosensors based on SPAC4D7.02c allows:

    • Monitoring conformational changes upon activation

    • Detecting protein-protein interactions in real-time

    • Visualizing enzyme activity in specific cellular locations

  • Immunogold electron microscopy: For ultrastructural localization studies:

    • Provides nanometer-scale resolution

    • Reveals association with specific membrane structures

    • Allows quantitative analysis of protein distribution

A methodological workflow might include:

TechniqueApplicationExpected Outcome
Confocal microscopyInitial localization studiesGeneral distribution pattern
FRAPMobility analysisDiffusion rate, immobile fraction
Super-resolutionDetailed localizationNanoscale distribution patterns
Electron microscopyUltrastructural contextPrecise membrane association

For optimal results, consider using S. pombe strains expressing SPAC4D7.02c at endogenous levels to avoid artifacts from overexpression, and validate observations with immunofluorescence using antibodies against the native protein .

What are the emerging techniques that could advance SPAC4D7.02c research?

Several cutting-edge technologies show promise for advancing SPAC4D7.02c research:

  • CRISPR-Cas9 genome editing: Enables precise modification of SPAC4D7.02c in its native genomic context, allowing:

    • Introduction of point mutations to study structure-function relationships

    • Creation of conditional alleles for temporal control of expression

    • Addition of endogenous tags for visualization or purification

  • Cryo-electron microscopy: Recent advances in resolution make it possible to:

    • Determine the structure of SPAC4D7.02c in different functional states

    • Visualize the enzyme in complex with membrane substrates

    • Understand conformational changes associated with activation

  • Single-molecule enzymology: Allows observation of individual enzyme molecules to:

    • Detect transient intermediates in the catalytic cycle

    • Identify heterogeneity in enzyme behavior

    • Measure conformational dynamics during catalysis

  • Proximity labeling proteomics: Techniques like BioID or APEX can:

    • Identify proteins that interact with SPAC4D7.02c in living cells

    • Map the protein neighborhood within cellular compartments

    • Discover new components of phospholipase signaling networks

  • Advanced lipidomics: Mass spectrometry-based approaches enable:

    • Comprehensive analysis of phospholipid substrates and products

    • Detection of low-abundance signaling lipids

    • Temporal profiling of lipid changes in response to SPAC4D7.02c activity

These emerging techniques, combined with the established methods discussed in previous sections, will likely drive significant advances in understanding the structure, function, and regulation of SPAC4D7.02c in the coming years.

How can integrative approaches enhance our understanding of SPAC4D7.02c function?

Integrative approaches combining multiple techniques and perspectives offer the most comprehensive understanding of SPAC4D7.02c function:

  • Multi-omics integration: Combining:

    • Proteomics to identify interaction partners

    • Transcriptomics to understand gene expression changes

    • Lipidomics to profile substrate and product dynamics

    • Metabolomics to capture downstream metabolic effects

  • Structural biology with functional studies: Linking:

    • High-resolution structures of SPAC4D7.02c

    • Site-directed mutagenesis of key residues

    • Enzymatic activity measurements

    • In vivo functional assays

  • Computational and experimental approaches: Integrating:

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Docking studies to identify potential inhibitors

    • Experimental validation of predicted binding modes

    • Systems biology modeling of pathway dynamics

  • Evolutionary and comparative analyses: Combining:

    • Phylogenetic analysis of phospholipase C enzymes

    • Functional characterization across species

    • Structural comparison of homologous enzymes

    • Reconstitution studies in heterologous systems

The power of integration is exemplified by studies of phospholipase signaling in S. pombe, where the reconstitution of mammalian components has provided insights into both the basic mechanisms of enzyme function and the evolution of regulatory systems . Similar approaches with SPAC4D7.02c would likely yield significant advances in understanding this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.