Recombinant Schizosaccharomyces pombe Plasma membrane proteolipid 31 (pmp31)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Schizosaccharomyces pombe Plasma membrane proteolipid 31 (pmp31) is a synthetic protein derived from the fission yeast Schizosaccharomyces pombe. It is encoded by the pmp31 gene (also known as mug75 or SPCC1183.09c) and is associated with plasma membrane functions . The recombinant form is engineered for research purposes, enabling studies on its structural, biochemical, and functional properties.

Gene and Protein Information

AttributeDetails
Gene Namepmp31 (Plasma membrane proteolipid 31)
Synonymsmug75, SPCC1183.09c, Meiotically up-regulated gene 75 protein
Protein LengthFull-length: 105 amino acids (1–105)
UniProt IDO74837
Amino Acid SequenceMSNVTLSDFLLIVLSFFVPFIVVGIRRGFCTADFLINICLCALGIPGIIHAIYIVIKYPR TVRLDIENSPNDPLVRYTPNPEHAVSPHSGPAPPSYSSLASNGMP

Recombinant Modifications

  • Tags: His-tagged versions are commonly produced for purification and detection .

  • Purity: ≥85% (SDS-PAGE) , with some commercial products achieving >90% purity .

  • Host Systems: Expressed in E. coli, yeast, baculovirus, or mammalian cells .

Expression Platforms

HostApplications
E. coliHigh-yield production; His-tagged fusion proteins for affinity chromatography
Yeast/BaculovirusNative folding and post-translational modifications (e.g., glycosylation)
Mammalian CellsComplex membrane protein studies requiring eukaryotic processing

Research Applications

ApplicationDetails
Protein InteractionsStudying membrane-associated complexes or lipid-binding properties
Structural AnalysisX-ray crystallography or NMR using recombinant His-tagged proteins
Functional AssaysReconstituting membrane vesicles to test transport or signaling activities

Product Comparison

VendorProduct IDHostTagPurityPrice
Creative BioMartRFL18881SFE. coliHis>90%Inquire
MyBioSourceMBS1179645E. coli/YeastN/A≥85%Variable
GenScriptOSc99031N/A (ORF clone)N/AN/ACustom cloning

Antibody Availability

  • Rabbit Polyclonal Antibody: Validated for ELISA and Western blot (Cusabio, CSB-PA530425XA01SXV) .

  • Reactivity: Specific to S. pombe (strain 972/ATCC 24843) .

Techniques

  • Western Blot (WB): Detects pmp31 using anti-pmp31 antibodies .

  • ELISA: Quantifies protein concentrations in solution .

  • SDS-PAGE: Confirms molecular weight (~12 kDa) .

Research Findings and Biological Significance

While pmp31 itself remains understudied, its association with meiotic regulation and membrane functions aligns with broader S. pombe research. For example:

  • Mitochondrial Translation: PPR proteins in S. pombe regulate mitochondrial mRNA metabolism, highlighting the importance of membrane-associated proteins in organelle function .

  • Genome-Wide Analyses: Recombinant protein libraries enable systematic studies of fission yeast gene function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
pmp31; mug75; SPCC1183.09c; Plasma membrane proteolipid 31; Meiotically up-regulated gene 75 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pmp31
Target Protein Sequence
MSNVTLSDFLLIVLSFFVPFIVVGIRRGFCTADFLINICLCALGIPGIIHAIYIVIKYPR TVRLDIENSPNDPLVRYTPNPEHAVSPHSGPAPPSYSSLASNGMP
Uniprot No.

Target Background

Function
Recombinant Schizosaccharomyces pombe Plasma membrane proteolipid 31 (pmp31) plays a role in meiosis.
Database Links
Protein Families
UPF0057 (PMP3) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the prp31+ gene in Schizosaccharomyces pombe and what is its primary function?

The prp31+ gene in Schizosaccharomyces pombe encodes a protein (Prp31p) that functions as a general splicing factor essential for both vegetative growth and sexual differentiation. Prp31p is closely related to human and budding yeast PRP31 homologs and is involved in the assembly of the spliceosome by recruiting the U4/U6×U5 tri-snRNP to prespliceosome complexes. The gene is essential for normal mRNA splicing throughout the fission yeast life cycle . Mutations in prp31+ lead to defects in both vegetative cell growth and meiotic progression, indicating its critical role in fundamental cellular processes .

How does prp31+ compare between S. pombe and other model organisms?

Prp31p shows strong conservation between S. pombe, S. cerevisiae, and human homologs, suggesting it performs similar core functions across eukaryotes. This conservation reflects the importance of the splicing mechanism across species. Unlike some other components of RNA processing machinery that vary between species, prp31+ appears to be part of the essential conserved module of RNA processing . This conservation makes S. pombe prp31+ studies particularly valuable for understanding human splicing mechanisms and related disorders .

What phenotypes are associated with prp31+ mutations in S. pombe?

Temperature-sensitive mutations in prp31+ (such as prp31-E1) result in several distinct phenotypes:

  • Vegetative growth defects with a cell division cycle (cdc)-like phenotype at restrictive temperatures

  • Meiotic progression defects with significant reduction in the ability to complete meiosis at restrictive temperatures

  • Pre-mRNA splicing defects

  • Synthetic lethality when combined with mutations in prp6

These phenotypes can be observed through various experimental approaches including DNA content analysis by FACS, nuclear counting, and meiotic progression monitoring in temperature-controlled environments .

What molecular mechanisms underlie the synthetic lethality between prp31 and prp6 mutations?

The synthetic lethality between prp31 and prp6 mutations likely stems from their cooperative roles in spliceosome assembly. Prp31p is involved in recruiting the U4/U6×U5 tri-snRNP to prespliceosome complexes, while Prp6 also plays a critical role in spliceosome assembly . When both proteins are compromised, the cell cannot effectively assemble functional spliceosomes, resulting in catastrophic failure of pre-mRNA processing. This synthetic lethality highlights the complex interdependencies within the splicing machinery .

For researchers investigating this interaction, approaches should include:

  • Conditional expression systems to manipulate both genes

  • Co-immunoprecipitation studies to examine physical interactions

  • In vitro splicing assays to measure sequential assembly defects

  • Genetic suppressor screens to identify additional interacting factors

How can targeted genome integration techniques be optimized for working with prp31+ in S. pombe?

Optimizing targeted integration at the prp31+ locus, which may have low gene targeting efficiency (under 5% for some loci), can be achieved through several approaches:

  • Modified transformation procedures can increase efficiency up to 5-fold when using antibiotic-based dominant selection markers .

  • Removal of pku70+ and pku80+ genes, which encode DNA end binding proteins required for non-homologous end joining (NHEJ), can dramatically increase gene targeting efficiency to approximately 75-80% (a 16-fold improvement) .

  • Using specialized vectors designed for S. pombe:

    • pINTL and pINTK vectors using ura4+ selection for disruptive integration of leu1+ and lys1+

    • pINTH vectors exploiting nourseothricin resistance to detect targeted disruption

    • Multi-copy expression vectors using resistance to nourseothricin or kanamycin/G418

  • Implementation of a natMX6/rpl42+ cassette system for both positive and negative selection during targeted integration .

What is the relationship between prp31+ function and cell cycle progression in S. pombe?

The prp31-E1 mutant exhibits a cell division cycle (cdc)-like phenotype at restrictive temperatures, indicating a close relationship between pre-mRNA splicing and cell cycle progression . This connection likely stems from the requirement for proper splicing of cell cycle regulatory genes. Several observations support this relationship:

  • Multiple pre-mRNA processing (prp) mutants in fission yeast show cell cycle defects, suggesting a general connection between splicing and cell cycle regulation .

  • Temperature-sensitive prp31-E1 mutants arrest with specific cell cycle phenotypes, indicating checkpoint activation in response to splicing defects .

  • The effects on both vegetative growth and meiotic progression suggest prp31+ function impacts different modes of cell division .

This relationship presents opportunities for studying how post-transcriptional regulation interfaces with cell cycle control mechanisms in eukaryotes .

What techniques can be used for studying prp31+ function in meiotic progression?

Several methodologies can effectively investigate prp31+ function during meiotic progression:

  • Temperature-sensitive mutant approach:

    • Using pat1-114 prp31-E1 cells arrested in G1 by nitrogen starvation

    • Releasing to meiosis by re-feeding and shifting to restrictive temperature

    • Monitoring progression through DNA content analysis (FACS) and nuclei counting

  • Homozygous mutant diploid analysis:

    • Constructing homozygous prp31 mutant diploids using complementation of ade6-M210 and ade6-M216 markers

    • Arresting cells in G2 of vegetative cycle by starvation

    • Releasing to meiosis at restrictive temperature with glucose and glycerol addition

    • Measuring completion of meiosis by counting percentage of asci formed

  • Data collection protocols:
    When collecting data from these experiments, researchers should organize their findings in clearly labeled tables as shown below:

Time (hours)DNA Content (FACS)% Cells with 1 Nucleus% Cells with 2 Nuclei% Cells with >2 NucleiSample Size
01C95%5%0%200
21C-2C80%20%0%200
42C60%35%5%200
62C30%40%30%200
82C15%25%60%200

Table 1: Example data collection format for monitoring meiotic progression in S. pombe. Data should be recorded with consistent precision across all measurements, with appropriate sample sizes to ensure statistical validity.

What cloning strategies are most effective for isolating and manipulating the prp31+ gene?

Based on successful approaches documented in the literature, the following cloning strategies are recommended for isolating and manipulating prp31+:

  • Complementation cloning:

    • Transform prp31-E1 temperature-sensitive mutants with a genomic library (such as pUR19)

    • Allow phenotypic expression at permissive temperature (25°C) for 48 hours

    • Shift to restrictive temperature (36°C) to select for complementation

    • Isolate plasmids from temperature-sensitive positive candidates

    • Transform into E. coli for restriction analysis and sequencing

  • Subcloning for functional analysis:

    • After identifying overlapping restriction fragments, sequence ~700 nt at either end

    • Identify open reading frames (ORFs)

    • Generate specific subclones of each ORF for functional testing

    • Use enzymes like SphI for generating specific fragments

  • Vector selection for expression analysis:

    • For expression studies, multi-copy vectors with resistance to nourseothricin or kanamycin/G418 are recommended for prototrophic hosts

    • For targeted genomic integration, pINTL, pINTK, and pINTH vector series provide versatile options

How can researchers effectively analyze pre-mRNA splicing defects in prp31 mutants?

Analysis of pre-mRNA splicing defects in prp31 mutants requires a systematic approach:

  • RNA extraction and quality control:

    • Extract total RNA from mutant and wild-type cells at both permissive and restrictive temperatures

    • Assess RNA integrity using gel electrophoresis or Bioanalyzer

    • Quantify RNA using spectrophotometric methods

  • Detection of unspliced precursors:

    • Design RT-PCR primers spanning intron-exon boundaries

    • Quantify the ratio of spliced to unspliced transcripts

    • Compare intron retention profiles between wild-type and mutant strains

    • Use multiple target genes to differentiate between general and transcript-specific effects

  • Global splicing analysis:

    • RNA-Seq to identify genome-wide splicing defects

    • Analyze for intron retention, exon skipping, and alternative splice site usage

    • Focus on cell cycle regulatory genes to correlate with observed phenotypes

  • Data analysis protocol:

    • Calculate splicing efficiency using the formula:
      Splicing Efficiency (%) = [Spliced Product / (Spliced Product + Unspliced Precursor)] × 100

    • Compare data across multiple biological replicates

    • Perform statistical analysis to determine significance of observed differences

How can the study of S. pombe prp31+ inform understanding of human splicing disorders?

The high degree of conservation between S. pombe Prp31p and human PRP31 makes this research particularly relevant to human disease studies. Mutations in human PRPF31 (the homolog of S. pombe prp31+) are associated with autosomal dominant retinitis pigmentosa (adRP), a degenerative eye disease . Research applications include:

  • Using S. pombe as a model system to characterize disease-causing mutations identified in humans

  • Screening for genetic interactions that may modify the effects of PRPF31 mutations

  • Testing potential therapeutic approaches that might restore proper splicing function

  • Investigating tissue-specific effects of splicing defects that might explain why PRPF31 mutations primarily affect retinal cells despite being ubiquitously expressed

What insights does the evolutionary conservation of prp31+ provide about core eukaryotic processes?

The evolutionary conservation of prp31+ across distantly related species provides significant insights:

  • The splicing mechanism represents a fundamental process that arose early in eukaryotic evolution and has been maintained under strong selective pressure .

  • Analysis reveals that S. pombe and S. cerevisiae share an essential protein module in their Mediator complexes, which associates with nonessential species-specific subunits .

  • Eight of ten essential genes conserved between S. pombe and S. cerevisiae also have metazoan homologs, indicating an evolutionary conserved core in all eukaryotic cells .

  • This conservation suggests a closer functional relationship between yeast and metazoan RNA processing machinery than previously recognized, with implications for using yeast as models for human disease .

  • The species-specific components that associate with these conserved modules likely reflect adaptations to different cellular environments and regulatory requirements .

What are the most promising future research directions for prp31+ studies?

Future research directions that show particular promise include:

  • Structural biology approaches:

    • Cryo-EM studies of the S. pombe spliceosome focusing on Prp31p interactions

    • Comparative structural analysis between species to identify functional domains

  • Integrative genomics:

    • Combining transcriptomics, proteomics, and genetic interaction studies

    • Identifying the complete network of genes affected by prp31+ function

  • Translational research:

    • Development of S. pombe-based screening platforms for identifying compounds that can suppress splicing defects

    • Testing therapies that may correct splicing anomalies in human disease models

  • Advanced genetic manipulation:

    • Applying CRISPR/Cas9 technologies optimized for S. pombe

    • Creating libraries of prp31+ variants to map structure-function relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.