Recombinant Schizosaccharomyces pombe PRA1-like protein (SPCC306.02c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe PRA1-like protein (SPCC306.02c) is a protein produced in Schizosaccharomyces pombe (Fission yeast), specifically strain 972 / ATCC 24843 . The protein is also referred to as PRA1-like protein and is encoded by the ORF (open reading frame) SPCC306.02c .

Basic Characteristics

CharacteristicDescription
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Protein NamesPRA1-like protein
ORF NameSPCC306.02c
Expression RegionAmino acids 1-171
AA SequenceMSALSLSITKVSETFSEIYASRAQYLSGFKSVGEFLDVRRISRPRNFSEAQSRISFNFSRFSSNYLAIIAMLVIYALIRNPLLLIVIGIGVGGVYGIRKLQGADLQLSHRVISNQNLYVILACVLIPLGLFASPIETIIWLVGASCVCVFGHAAFFEPPVESAFETVEQQV
UniProt AccessionQ9UUN5

Function and Role in Schizosaccharomyces pombe

While specific details on the precise function of SPCC306.02c are not available in the provided references, studies on Schizosaccharomyces pombe and related proteins indicate involvement in various cellular processes:

  • Response to Stress: S. pombe utilizes various proteins to respond to stress, such as salt shock, and to maintain cell integrity .

  • Iron Homeostasis: Proteins like Grx4, Fep1, and Php4 are involved in iron homeostasis. Fep1, for example, regulates the expression of genes related to iron acquisition depending on iron levels .

  • Protein Secretion: High-level protein secretion can cause changes in protein expression levels, affecting protein production and secretion in S. pombe .

  • Cell Wall Maintenance: Protein kinase C homologues, Pck1p and Pck2p, are required for maintaining cell integrity, and defects related to the cell wall can arise in pck1delta and pck2delta strains, suggesting their involvement in cell wall regulation .

Recombinant Production and Applications

Recombinant SPCC306.02c is available for purchase in various sizes for research purposes . The tag type for the recombinant protein is determined during the production process. It is typically stored in a Tris-based buffer with 50% glycerol .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SPCC306.02c; PRA1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC306.02c
Target Protein Sequence
MSALSLSITKVSETFSEIYASRAQYLSGFKSVGEFLDVRRISRPRNFSEAQSRISFNFSR FSSNYLAIIAMLVIYALIRNPLLLIVIGIGVGGVYGIRKLQGADLQLSHRVISNQNLYVI LACVLIPLGLFASPIETIIWLVGASCVCVFGHAAFFEPPVESAFETVEQQV
Uniprot No.

Target Background

Database Links
Protein Families
PRA1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What cellular localization patterns are exhibited by PRA1-like proteins in S. pombe?

PRA1-like proteins in S. pombe display complex, dynamic localization patterns:

  • While traditionally described as Golgi-resident proteins, endogenous PRA1 family proteins have been shown to localize to multiple compartments

  • A significant subpopulation resides at ER-mitochondria membrane contact sites

  • The protein's localization is regulated by its N-terminal motifs: the di-arginine motif and the FFAT-like motif influence retention in the ER

  • Interestingly, addition of tags to either N- or C-termini can dramatically alter localization patterns between the Golgi and reticular ER, suggesting caution when using tagged constructs

Double-labeling experiments with MitoTracker have demonstrated extensive co-localization of PRA1 with mitochondria, although this co-localization is not absolute, with some PRA1 immunoreactivity extending beyond the mitochondrial interface .

What expression systems are optimal for producing recombinant S. pombe PRA1-like protein?

For recombinant expression of S. pombe PRA1-like protein (SPCC306.02c), several systems have proven effective:

E. coli expression system:

  • Most commonly used for producing His-tagged versions of the full-length protein (amino acids 1-171)

  • Provides high yields but requires optimization of solubilization conditions due to the hydrophobic transmembrane domains

Baculovirus expression system:

  • Offers superior post-translational modifications and membrane protein folding

  • Has been successfully used for related S. pombe proteins, such as the origin recognition complex containing Orc4 protein

  • Allows co-expression with interacting partners for complex formation

S. pombe homologous expression:

  • Can be achieved using vectors like pREP1 or pCAD1

  • Allows for native post-translational modifications and proper membrane insertion

  • Integration into the leu1 locus has been successful for expressing membrane proteins

When designing expression constructs, care must be taken with tag placement, as N- or C-terminal tags can significantly alter localization and potentially function .

What purification challenges are specific to SPCC306.02c and how can they be overcome?

Purification of SPCC306.02c presents several challenges typical of multi-pass transmembrane proteins:

Challenges:

  • Poor solubility due to four transmembrane domains

  • Potential aggregation during extraction from membranes

  • Maintaining native conformation during purification

  • Low expression yields compared to soluble proteins

Methodological solutions:

  • Optimized detergent selection:

    • Use of mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Detergent screening to identify optimal solubilization conditions

  • Two-phase extraction approach:

    • Initial membrane preparation using ultracentrifugation

    • Sequential solubilization with increasing detergent concentrations

  • Affinity purification strategies:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged versions

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Stabilization techniques:

    • Addition of glycerol (up to 50%) in storage buffers

    • Use of Tris-based buffers optimized for protein stability

    • Storage at -20°C or -80°C to prevent degradation

    • Avoidance of repeated freeze-thaw cycles

When analyzing purified protein, it's recommended to verify proper folding using circular dichroism or limited proteolysis .

How can interactions between SPCC306.02c and Rab GTPases be experimentally verified?

Several complementary approaches can be used to verify and characterize interactions between SPCC306.02c and Rab GTPases:

In vitro techniques:

  • GST pull-down assays:

    • Express SPCC306.02c as a fusion protein with GST

    • Immobilize on glutathione resin and incubate with purified Rab GTPases

    • Analysis by Western blotting can detect direct interactions

  • Co-immunoprecipitation:

    • Can be performed with epitope-tagged versions of both proteins

    • Important to use GTP-locked mutants of Rab proteins to detect interactions, as PRA1 proteins typically interact preferentially with GTP-bound forms

In vivo techniques:

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Express SPCC306.02c fused to Renilla luciferase (Rluc) and potential Rab interactors fused to GFP²

    • Interactions can be detected without external excitation light

    • Competition with untagged proteins can verify specificity

  • Yeast two-hybrid screening:

    • Has been successful in identifying PRA1 interactions with various partners

    • Requires careful design of constructs to avoid transmembrane domains

  • Live cell imaging:

    • Fluorescently tagged proteins can be used to assess co-localization

    • Techniques like Fluorescence Recovery After Photobleaching (FRAP) can assess dynamics of interactions

When studying these interactions, it's critical to consider that:

  • Tag position can significantly affect results

  • PRA1 proteins may interact with specific Rab subtypes

  • Interactions may be transient or regulated by additional factors

What techniques are most effective for studying SPCC306.02c's role in membrane trafficking?

Investigating SPCC306.02c's role in membrane trafficking requires a multi-faceted approach:

Genetic approaches:

  • Gene deletion or knockdown:

    • Creation of pra1-null mutants using PCR-based gene deletion procedures

    • Analysis of resulting phenotypes related to membrane trafficking

    • Essential gene analysis using temperature-sensitive mutants if the gene is essential

  • Point mutations of key motifs:

    • Targeted mutagenesis of the di-arginine and FFAT-like motifs

    • Assessment of effects on protein localization and trafficking

    • Export mutants (like PRA1 AA) can help identify specific domains required for proper localization

Cell biological approaches:

  • Live cell imaging with compartment markers:

    • Co-expression of SPCC306.02c with markers for Golgi, ER, and mitochondria

    • Tracking protein movement using photoactivatable fluorescent proteins

    • Quantitative co-localization analysis using specialized software

  • Cargo trafficking assays:

    • Monitor the movement of model cargo proteins in cells with altered SPCC306.02c levels

    • Pulse-chase experiments to track protein movement through secretory pathway

    • Analysis of trafficking rates and efficiency

  • Electron microscopy:

    • Immunogold labeling to precisely localize SPCC306.02c at the ultrastructural level

    • Analysis of membrane contact sites and organelle morphology

    • Correlative light and electron microscopy for dynamic analysis

When interpreting results, it's important to consider that perturbation of SPCC306.02c may have indirect effects on membrane trafficking due to altered membrane composition or structure .

What advantages does S. pombe offer as a model system for studying PRA1 protein function?

S. pombe offers several distinct advantages for studying PRA1 protein function:

Genetic tractability:

  • Haploid genome simplifies genetic manipulation

  • High efficiency of homologous recombination facilitates targeted gene modification

  • Only 4,940 protein-coding genes, the smallest number in any sequenced eukaryote, making comprehensive studies feasible

Evolutionary conservation:

  • Approximately 70% of S. pombe genes have human orthologs, including many disease-relevant genes

  • Conserved membrane trafficking machinery and organelle organization

  • PRA1 family proteins are conserved from yeast to human, allowing evolutionary insights

Cell biological advantages:

  • Regular rod-shaped cells with predictable growth patterns

  • Well-characterized cell cycle with distinct phases

  • Excellent visualization of organelles and membrane structures

  • Extensive collection of mutant strains and genetic resources

Practical advantages:

  • Complete genome sequence available through PomBase

  • Proteome-wide localization data using GFP tagging

  • Established protocols for genetic manipulation and protein expression

  • Ability to screen approximately 160 natural strains with genetic diversity

For PRA1 specifically, S. pombe allows investigation of fundamental conserved functions in a simpler system before moving to more complex eukaryotes .

How do PRA1-like proteins in S. pombe compare functionally to their homologs in other organisms?

PRA1-like proteins show both conserved and divergent functions across species:

Conserved features:

  • Four-pass transmembrane topology is maintained from yeast to humans

  • Involvement in membrane trafficking and organelle dynamics

  • Ability to interact with small GTPases, particularly Rab family proteins

  • Localization to the early secretory pathway

Functional comparisons:

  • S. pombe vs. S. cerevisiae:

    • Both yeasts utilize PRA1 family proteins in secretory pathways

    • In S. cerevisiae, PRA1 homologs interact with Rho GTPases (rho1p and rho2p) in a GTP-dependent manner

    • S. pombe PRA1-like protein shows distinct interaction domains compared to S. cerevisiae homologs

  • S. pombe vs. mammals:

    • Mammalian PRA1 (RABAC1) associates with over 40 Rab GTPases

    • Human PRA1 family protein 3 (ARL6IP5) has additional roles in regulating glutamate transport

    • Mammalian PRA1 proteins show more diverse subcellular localizations

    • Retention motifs (di-arginine and FFAT-like) are highly conserved from yeast to humans

  • S. pombe vs. plants:

    • In plants (e.g., S. lycopersicum), SlPRA1A regulates receptor-like protein (RLP) localization

    • Plant PRA1 proteins can influence immune responses via degradation of pattern recognition receptors

    • Plant PRA1 proteins interact with RAB GTPases similar to yeast homologs

The evolutionary conservation of core functions alongside species-specific adaptations makes comparative studies particularly valuable for understanding fundamental vs. specialized roles of PRA1 family proteins .

How can proteomics approaches be used to identify the interactome of SPCC306.02c in S. pombe?

Comprehensive mapping of the SPCC306.02c interactome requires specialized proteomics approaches:

Affinity purification-mass spectrometry (AP-MS):

  • BioID proximity labeling:

    • Fusion of SPCC306.02c with a biotin ligase (BirA*)

    • Biotinylation of proximal proteins in living cells

    • Streptavidin purification followed by mass spectrometry

    • Particularly valuable for capturing transient interactions at membrane interfaces

  • SILAC-based quantitative proteomics:

    • Metabolic labeling of S. pombe cells with heavy/light amino acids

    • Comparison of protein interactions between wild-type and mutant conditions

    • Allows statistical evaluation of interaction specificity

  • Comparative proteome analysis:

    • Analysis of global proteome changes in strains expressing different levels of SPCC306.02c

    • Can reveal indirect functional connections through pathway analysis

    • Previously used successfully with S. pombe strains producing varying levels of recombinant proteins

Validation approaches:

  • Reciprocal tagging and pull-down of identified interaction partners

  • Co-localization studies using fluorescence microscopy

  • Genetic interaction studies (synthetic lethality/sickness screens)

When analyzing membrane protein interactomes, special consideration must be given to detergent choice, as improper solubilization can disrupt genuine interactions. Crosslinking strategies may help preserve interactions during purification .

What are the challenges in crystallizing SPCC306.02c for structural studies and how might they be overcome?

Membrane proteins like SPCC306.02c present significant challenges for structural studies:

Key challenges:

  • Expression and purification hurdles:

    • Low natural abundance requires recombinant expression

    • Hydrophobic nature causes aggregation

    • Maintaining proper folding during extraction from membranes

  • Crystallization-specific challenges:

    • Detergent micelles complicate crystal packing

    • Conformational heterogeneity reduces crystal quality

    • Limited polar surfaces for crystal contacts

Strategic approaches:

  • Construct engineering:

    • Removal of flexible regions while preserving core domains

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Targeted surface mutations to enhance crystal contacts

    • Focus on the N-terminal region containing regulatory motifs as an initial target

  • Alternative crystallization methods:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization systems

    • Detergent screening arrays to identify optimal conditions

    • Nanodiscs or amphipols to maintain native-like lipid environment

  • Complementary structural approaches:

    • Cryo-electron microscopy (does not require crystals)

    • Nuclear magnetic resonance (NMR) for isolated domains

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict conformational states

    • Integration of limited experimental data with computational models

While no crystal structure of SPCC306.02c has been reported, the expanding toolkit for membrane protein structural biology makes this an increasingly feasible goal .

How might SPCC306.02c function at ER-mitochondria membrane contact sites in S. pombe?

Recent research has revealed that PRA1 family proteins can localize to ER-mitochondria membrane contact sites, suggesting specialized functions:

Potential functional roles:

  • Lipid transfer:

    • PRA1 proteins may facilitate transfer of specific lipids between ER and mitochondrial membranes

    • The four transmembrane domains could create a hydrophobic channel

    • FFAT-like motifs have been implicated in interactions with VAP proteins, known mediators at membrane contact sites

  • Calcium signaling:

    • Membrane contact sites are critical for calcium regulation between ER and mitochondria

    • PRA1 might influence structure or composition of these contact sites

    • Could modulate activity of calcium channels or transporters at these junctions

  • Organelle dynamics:

    • Potential role in regulating mitochondrial fission/fusion events

    • Could influence recruitment of dynamin-related proteins

    • May stabilize physical connections between organelles

Experimental approaches to investigate these functions:

  • Electron microscopy to visualize ultrastructure of contact sites in wild-type vs. deletion strains

  • Calcium imaging using genetically encoded calcium indicators

  • Lipid transfer assays using fluorescent lipid analogs

  • Proximity labeling to identify molecular components of contact sites

  • Live cell imaging to track dynamics of contact sites during cell cycle or stress conditions

The localization of PRA1 to these specialized membrane domains opens entirely new avenues for understanding its cellular functions beyond traditional Rab-related activities .

What are common issues in immunodetection of SPCC306.02c and how can they be resolved?

Researchers face several challenges when detecting SPCC306.02c via immunological methods:

Common issues and solutions:

  • Low antibody specificity:

    • Generation of specific antibodies against membrane proteins is challenging

    • Solution: Use multiple antibodies targeting different epitopes for validation

    • Solution: Include appropriate knockout/knockdown controls

    • Commercial polyclonal antibodies against full-length protein have been successfully used

  • Poor membrane protein extraction:

    • Four transmembrane domains make extraction difficult

    • Solution: Optimize detergent type and concentration (e.g., Triton X-100, NP-40, CHAPS)

    • Solution: Include sample heating steps in SDS-containing buffers (70°C for 10 minutes)

    • Solution: Add urea (up to 8M) for complete denaturation in difficult cases

  • Inconsistent localization patterns:

    • Different fixation methods can alter apparent localization

    • Solution: Compare multiple fixation protocols (paraformaldehyde, methanol, glutaraldehyde)

    • Solution: Use live cell imaging with fluorescently tagged versions

    • Solution: Validate with subcellular fractionation followed by Western blotting

  • Problems with epitope accessibility:

    • Transmembrane topology may mask epitopes

    • Solution: Test antibodies targeting different regions (N-terminal, C-terminal, loop regions)

    • Solution: Mild permeabilization with digitonin can help distinguish cytoplasmic vs. luminal epitopes

  • Cross-reactivity with other PRA1 family members:

    • Sequence similarity can lead to non-specific recognition

    • Solution: Validate antibody specificity using recombinant proteins

    • Solution: Pre-absorb antibodies with recombinant related proteins

When designing experiments, it's also important to note that tagging SPCC306.02c can significantly alter its localization pattern, with N- or C-terminal tags driving different subcellular distributions that may not match endogenous protein .

How should genetic manipulation strategies for SPCC306.02c be adjusted if it proves to be an essential gene?

If SPCC306.02c is found to be essential, several alternative genetic approaches can be employed:

Conditional knockdown/knockout strategies:

  • Temperature-sensitive alleles:

    • Generate conditional mutations that maintain function at permissive temperature

    • Shift to restrictive temperature to observe loss-of-function phenotypes

    • Random mutagenesis followed by screening, or targeted mutation of conserved residues

  • Repressible promoter systems:

    • Replace native promoter with regulatable promoter (e.g., nmt1 promoter)

    • The nmt1 promoter is thiamine-repressible in S. pombe

    • Modulate expression levels by varying thiamine concentration

  • Degron-based approaches:

    • Fusion with auxin-inducible degron (AID) tag

    • Allows rapid, tunable protein depletion upon auxin addition

    • Can be combined with fluorescent tags for simultaneous visualization

Partial function analysis:

  • Domain-specific mutations:

    • Target specific functional domains like the di-arginine or FFAT-like motifs

    • Create point mutations rather than complete gene deletion

    • Analyze separation-of-function phenotypes

  • Heterozygous diploid analysis:

    • Create heterozygous diploid strains (one wild-type copy, one deleted)

    • Look for haplo-insufficiency phenotypes

    • Can reveal dosage-sensitive functions

According to genome-wide studies in S. pombe, approximately 17.5% of genes are essential. The likelihood of essentiality correlates with evolutionary conservation and the timing of appearance in the tree of life . When analyzing potential essentiality, it's important to consider both cell viability and specific cellular processes that may be affected even if the gene is not strictly essential for survival.

How do experimental approaches for studying SPCC306.02c differ from those used for other PRA1 family members?

Research on SPCC306.02c requires specialized approaches compared to other PRA1 family members:

Methodological differences:

AspectSPCC306.02c (S. pombe)Mammalian PRA1Plant PRA1
Expression systemsFission yeast expression systems; E. coli with solubilization optimizationMammalian cell lines; insect cells for membrane proteinsPlant expression systems; heterologous expression in N. benthamiana
Genetic manipulationPCR-based deletion methods; plasmid integration at leu1 locusCRISPR-Cas9 gene editing; siRNA knockdownT-DNA insertion mutants; virus-induced gene silencing
Interactome analysisFocus on Rab/Rho GTPases; co-IP from native membranesBroader interactor screening including SNAREs and receptorsEmphasis on pattern recognition receptors and immune regulators
Localization studiesDistinct methods needed to visualize ER-mitochondria contactsGreater focus on Golgi-endosome traffickingFocus on plasma membrane-endosome trafficking
Functional assaysCell wall biosynthesis; membrane composition analysisNeurotransmitter transport; receptor traffickingImmune response signaling; pathogen resistance

S. pombe-specific considerations:

  • Cell wall analysis is critical due to PRA1's potential role in cell wall biosynthesis in conjunction with Rho GTPases

  • Temperature sensitivity assays are particularly valuable in fission yeast

  • Cell cycle synchronization methods (such as nitrogen starvation or cdc25-22 blocks) allow investigation of cell cycle-dependent functions

When adapting methods from other systems, researchers should consider the distinct biology of fission yeast, including its rod-shaped morphology, fission-based division, and unique cell wall composition .

How does SPCC306.02c expression change during the cell cycle and under different stress conditions?

Understanding SPCC306.02c regulation requires analysis across different cellular states:

Cell cycle regulation:

  • Microarray analysis of synchronized S. pombe cells has revealed the expression patterns of most cell cycle-regulated genes

  • While not among the most strongly oscillating genes, many membrane trafficking proteins show moderate oscillation with peaks in G2 phase

  • This pattern correlates with increased protein synthesis and membrane growth during G2

  • Expression can be analyzed using cdc10-M17 or cdc25-22 block-release experiments

  • RNA-seq time course analysis following synchronization provides quantitative expression data

Stress response patterns:

Stress conditionEffect on SPCC306.02cPotential biological significance
Oxidative stressModerate inductionMembrane remodeling in response to oxidative damage; potential role in secretion of stress response proteins
Heat shockInduction observedContains heat shock elements (NGAAN) in promoter; may participate in proteostasis under thermal stress
Nitrogen limitationExpression changes correlate with G1 arrestMay regulate membrane trafficking during nutritional adaptation
Cell wall stressLikely inductionPotential role in coordinating membrane trafficking with cell wall repair mechanisms

Experimental approaches:

  • Quantitative PCR analysis:

    • Real-time monitoring of transcript levels under different conditions

    • Comparison with known stress-responsive genes as positive controls

  • Promoter-reporter fusion:

    • Fusion of SPCC306.02c promoter with fluorescent reporter

    • Live-cell imaging of expression dynamics under varying conditions

  • Western blot analysis:

    • Quantification of protein levels under stress conditions

    • Assessment of post-translational modifications that may regulate activity

Analysis of gene expression patterns can provide important clues to the physiological roles of SPCC306.02c beyond its basic membrane trafficking functions .

What emerging technologies could advance our understanding of SPCC306.02c function?

Several cutting-edge technologies offer promising avenues for deeper insights into SPCC306.02c:

Advanced imaging technologies:

  • Super-resolution microscopy:

    • PALM/STORM approaches can resolve protein localization at nanometer scale

    • Particularly valuable for studying membrane contact sites

    • Multi-color imaging to visualize protein complexes in situ

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence localization with ultrastructural context

    • Can reveal precise membrane topology of SPCC306.02c

    • Immunogold labeling for quantitative spatial analysis

Functional genomics approaches:

  • CRISPR base editing:

    • Precise introduction of specific mutations without double-strand breaks

    • Systematic mutation of conserved residues to map functional domains

    • Creation of allelic series to study structure-function relationships

  • Perturb-seq:

    • Combines CRISPR perturbations with single-cell RNA-seq

    • Can reveal transcriptional consequences of SPCC306.02c disruption

    • Identify cellular pathways affected by protein function

Biochemical and biophysical methods:

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Can determine stoichiometry and stability of interactions

    • Compatible with various membrane-mimetic systems

  • In-cell NMR:

    • Study protein dynamics and interactions in living cells

    • Can provide residue-level information on conformational changes

    • Particularly valuable for flexible protein regions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Maps protein-protein interaction surfaces

    • Identifies conformational changes upon binding

    • Compatible with membrane proteins when optimized

Integration of these technologies with traditional approaches will provide a more comprehensive understanding of SPCC306.02c's roles in cellular physiology .

What are the most promising applications of understanding SPCC306.02c function for broader cell biology?

Research on SPCC306.02c has implications extending beyond yeast biology:

Fundamental biological insights:

  • Membrane contact site biology:

    • Understanding how organelles communicate through physical connections

    • Mechanisms of lipid transfer between membranes

    • Role of specialized membrane domains in cellular compartmentalization

  • Protein trafficking regulation:

    • Evolution of trafficking machinery from simple to complex eukaryotes

    • Coordination of secretory pathway with cell growth and division

    • Mechanisms of protein quality control during trafficking

Biomedical applications:

  • Neurodegenerative disease insights:

    • Mammalian PRA1 homologs interact with proteins implicated in neurodegeneration

    • ER-mitochondria contacts are disrupted in several neurodegenerative conditions

    • Early downregulation of PRA1 observed in retinitis pigmentosa models

  • Cellular stress response mechanisms:

    • Understanding membrane remodeling during stress adaptation

    • Potential targets for enhancing cellular resilience

    • Role in protein homeostasis and quality control

Biotechnological applications:

  • Protein production systems:

    • Manipulation of trafficking pathways to enhance secretion of recombinant proteins

    • Comparative proteomics has identified SPCC306.02c as a potential target for improving protein secretion

    • Engineering membrane trafficking to overcome bottlenecks in heterologous protein expression

  • Synthetic biology tools:

    • Engineering novel membrane contact sites with specialized functions

    • Creating synthetic organelle communication systems

    • Development of biosensors based on membrane recruitment mechanisms

The evolutionary conservation of core trafficking machinery makes S. pombe an excellent model for understanding fundamental mechanisms with potential translational impact .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.