Recombinant Schizosaccharomyces pombe Presequence translocated-associated motor subunit pam17, mitochondrial (pam17)

Shipped with Ice Packs
In Stock

Description

Overview of Pam17 Function

Pam17 is a component of the PAM complex, which drives the import of preproteins into mitochondria . The mitochondrial heat shock protein 70 (mtHsp70) is the central component of PAM, generating an import driving activity that is ATP-dependent . Pam17 influences the association of Pam18 and Pam16 in the J-complex, which are also regulatory subunits of the PAM complex .

Interaction with the TIM23 Complex

Pam17 interacts with the Tim23 channel protein, indicating a binding site between the TIM23 complex and Pam17 . The TIM23 complex mediates the import of preproteins across the mitochondrial inner membrane . Tim44, another component, was initially thought to be a scaffold for binding motor subunits, but it plays a differential role in recruiting PAM modules to the inner membrane translocase .

Role of Tim44

Tim44 is an adaptor protein that binds mtHsp70 and links it to the TIM23 complex . Studies using a tim44-804 mutant have shown that Tim44 inactivation leads to a reorganization within the TIM23-PAM machinery . The J-complex dissociates from the translocase, while Pam17 binding to Tim23 is enhanced . This suggests Tim44 has a critical function in the dynamics of the mitochondrial import motor .

Pam17 in Saccharomyces cerevisiae

While Pam17 is conserved, its precise localization and role are unclear . It was identified as a component of the import motor in Saccharomyces cerevisiae .

Involvement in Mitochondrial Quality Control

Pam17 is required for the translocation activity and architecture of the mitochondrial protein import motor . It is also involved in quality control pathways of mitochondria . Deletion of PAM17 in the rsp5-1 yeast mutant results in a synthetic growth defect and accumulation of the Mdj1 precursor, indicating that Rsp5 has a role in the removal of non-imported preproteins .

Post-translational Roles

Homologs of Cbp3, Cbp6, and Mss51 in S. pombe function at post-translational steps of respiratory complex biogenesis, contrasting with their roles in Saccharomyces cerevisiae . These proteins are involved in the assembly of respiratory complexes III and IV .

Experimental Evidence

Studies on tim44-804 mutants show a selective import defect for precursors destined for the mitochondrial matrix . Inactivation of Tim44 leads to a reorganization within the TIM23-PAM machinery, enhancing Pam17 binding to Tim23 .

Table: Key Interactions and Functions of Pam17

Protein/ComplexInteractionFunction
mtHsp70Part of PAM complexDrives import of preproteins
Tim23Direct bindingPart of protein import channel
Tim44Indirect, through PAM complexDynamics of mitochondrial import motor
Pam18/Pam16 (J-complex)Influences associationRegulation of mtHsp70 activity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
pam17; SPAC167.04; Presequence translocated-associated motor subunit pam17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-209
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pam17
Target Protein Sequence
QSPKIFLTLWKTCYNVKTYSTESIKQKKPQDLNWPTFLKLRKSRRIFETLTSIPTALTGL GLGSAYFLTRTVDPTMTIMGLDLFTLYVIGTIASGGLGWLLGPSIGRKIWTLLHKSQARQ IAAREQEFYRHLVKNRVTPQMESYSNPIPDYYGEKIYSLSDYRRWLRDQKAYIQRAFWRT SNR
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the matrix.
Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.