Recombinant Schizosaccharomyces pombe Probable acyl-CoA desaturase (SPCC1281.06c)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

SPCC1281.06c encodes a probable acyl-CoA desaturase in the fission yeast Schizosaccharomyces pombe, classified under EC 1.14.19.1. This enzyme belongs to the stearoyl-CoA desaturase (SCD) family and functions as a Δ9-desaturase, introducing a double bond between carbons 9 and 10 of long-chain acyl-CoA substrates like stearoyl-CoA to produce oleoyl-CoA . Key features include:

  • Catalytic mechanism: Requires molecular oxygen, NAD(P)H, cytochrome b5 reductase, and cytochrome b5 as electron carriers .

  • Structural domains: Contains four transmembrane regions and a di-iron center critical for desaturase activity .

  • Biological role: Maintains membrane fluidity by balancing saturated and monounsaturated fatty acids (MUFAs) .

Biochemical Characteristics

  • Amino Acid Sequence: Comprises 479 residues, including conserved histidine-rich motifs (e.g., HXXXH) essential for iron coordination .

  • Substrate Specificity: Prefers C16–C18 acyl-CoA substrates, with stearoyl-CoA (C18:0) as the primary substrate .

  • Oxygen Dependency: Activity is tightly regulated by oxygen availability, linking it to hypoxic stress responses .

Table 2: Gene Expression and Functional Studies

Study FocusKey FindingsSource
Oxygen SensitivitySPCC1281.06c transcription increases 1.94-fold under anaerobic conditions via Sre1p regulation
Metabolic InterplayCo-expression with elongases enhances polyunsaturated fatty acid (PUFA) synthesis
Mga2 RegulationTranscriptional repression under low oxygen reduces MUFA production

Applications in Biotechnology and Research

  1. Lipid Metabolism Studies: Used to investigate MUFA biosynthesis and its role in cellular stress adaptation .

  2. Enzyme Activity Assays: Quantifies desaturase kinetics using radiolabeled substrates or mass spectrometry .

  3. Industrial Biotechnology: Engineered strains expressing SPCC1281.06c improve lipid profiles for biofuel production .

Challenges and Future Directions

  • Stability Issues: Recombinant protein requires glycerol stabilization and strict temperature control .

  • Substrate Channeling: Mechanisms of acyl-CoA delivery to the enzyme remain poorly understood .

  • Therapeutic Potential: SCD inhibitors are explored for metabolic disorders, but fungal vs. human isoform specificity remains a hurdle .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
SPCC1281.06c; Probable acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase; Stearoyl-CoA desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-479
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC1281.06c
Target Protein Sequence
MTAPSATAFSSATTQPTTEGNASMRKRTIPVVPSVPERKWDPKAPKHIQEQPWTMQNWWR HLNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGLGITAGYHRLWSHRAYKA KKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWMIILQN PRRIGRSDVSDLNSDPFVMFNHRHFLPIASFMAFIFPSLFCGLLWGDYRGGYFYAGVCRL VFVHHATFCVNSLAHLIGSQPFDDTNSARNHFITALVTLGEGNHNYHHAFPNDYRNGLRW YEYDPTKIFIYIASLFGLAYNLNTFPDNEIQKGIVQQKQKVLDRWRAKLNWGIPLEQLPV MEFEDFLEQSKTRPLVLINGVVHDMTGFEHPGGQGLLRSAFGKDATAAFNGGVYDHTNGA HNLLSTYRVAVVRGGMEVEVWKSGAGAQLPMKDTQGQKIVRVGEQITRIQPPIEAAAAN
Uniprot No.

Target Background

Function
This protein is a stearoyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. It catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates, including palmitoyl-CoA and stearoyl-CoA. This enzyme contributes to the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides.
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of acyl-CoA desaturase in Schizosaccharomyces pombe?

Acyl-CoA desaturase (SPCC1281.06c) in S. pombe plays a crucial role in fatty acid metabolism, specifically introducing double bonds into fatty acyl chains. This enzyme contributes significantly to membrane lipid composition by catalyzing the conversion of saturated fatty acids to monounsaturated fatty acids. In S. pombe, this enzyme is particularly important for maintaining proper membrane fluidity through the generation of unsaturated fatty acids, which influences membrane properties such as lipid packing and bilayer stiffness .

The enzyme appears to be downregulated under certain stress conditions, as evidenced in gene expression profiling data . This suggests its activity may be modulated as part of the cellular stress response, potentially to adjust membrane composition during adaptation to environmental changes.

How is SPCC1281.06c regulated at the transcriptional level?

SPCC1281.06c shows specific regulation patterns under various cellular conditions. Gene expression profiling data reveals that this acyl-CoA desaturase is downregulated under nitrosative stress conditions . The systematic study of gene expression changes in response to nitric oxide (NO) and reactive nitrogen intermediates (RNIs) demonstrated this downregulation, suggesting that fatty acid desaturation may be selectively suppressed during this type of cellular stress.

The transcriptional regulation likely involves multiple factors including:

  • Stress-responsive transcription factors that modulate lipid metabolism genes

  • Cellular redox state sensors that respond to nitrosative stress

  • Metabolic regulators that coordinate fatty acid synthesis with other cellular processes

  • Membrane homeostasis pathways that sense and respond to changes in membrane properties

Understanding these regulatory mechanisms provides insight into how S. pombe adapts its membrane composition in response to environmental challenges.

What structural features characterize the SPCC1281.06c protein?

The probable acyl-CoA desaturase (SPCC1281.06c) contains several characteristic domains and motifs common to desaturase enzymes. Although complete structural data isn't provided in the search results, typical features of these enzymes include:

  • Transmembrane domains that anchor the protein in the endoplasmic reticulum membrane

  • Histidine-rich motifs that coordinate iron atoms essential for catalytic activity

  • Substrate-binding regions that determine fatty acid chain length specificity

  • Cofactor-binding sites for electron transfer components

These structural elements work together to position the fatty acid substrate correctly for the desaturation reaction, which requires molecular oxygen and an electron transfer system. The precise structural details would require experimental determination through techniques such as X-ray crystallography or cryo-electron microscopy.

What experimental research designs are most appropriate for studying SPCC1281.06c function?

When investigating the function of SPCC1281.06c, several experimental research designs could be implemented depending on the specific research questions:

For gene expression and regulation studies, true experimental research with a pretest-posttest control group design would be most effective . This approach allows researchers to:

For protein function studies, quasi-experimental approaches might be necessary, particularly when working with cellular systems where complete randomization is not possible . This could involve:

  • Creating recombinant variants of the enzyme with specific mutations

  • Comparing enzymatic activity across different variants

  • Establishing structure-function relationships based on the results

The Solomon four-group design could be particularly valuable for comprehensive studies, as it would allow researchers to control for testing effects and provide multiple comparisons for robust data analysis .

What methods are most effective for recombinant expression of SPCC1281.06c?

For successful recombinant expression of SPCC1281.06c, researchers should consider the following methodological approach:

  • Expression System Selection: For a eukaryotic membrane protein like acyl-CoA desaturase, expression in yeast systems such as Pichia pastoris or specialized strains of Saccharomyces cerevisiae often yields better results than bacterial systems, as they provide the appropriate membrane environment and post-translational modifications.

  • Vector Design:

    • Include a strong inducible promoter (e.g., GAL1 for S. cerevisiae)

    • Add appropriate purification tags (His6 or FLAG) preferably at the C-terminus to minimize interference with membrane insertion

    • Consider including a TEV protease cleavage site for tag removal after purification

  • Optimization Parameters:

    • Induction conditions (temperature, inducer concentration, duration)

    • Growth media composition, particularly regarding fatty acid content

    • Cell density at induction time

  • Verification Methods:

    • Western blotting to confirm expression

    • Enzymatic activity assays to verify functional protein production

    • Membrane fractionation to confirm proper localization

Given the challenges with membrane protein expression, a comparative approach testing multiple expression systems simultaneously may be necessary to identify optimal conditions.

How can researchers measure acyl-CoA desaturase activity accurately?

Accurate measurement of acyl-CoA desaturase activity requires specialized techniques that account for both the membrane-bound nature of the enzyme and the specific biochemical reaction it catalyzes:

  • Substrate Preparation:

    • Prepare acyl-CoA substrates of appropriate chain lengths (typically C16:0, C18:0)

    • Ensure substrate solubility through proper detergent selection or micelle formation

  • Activity Assay Methods:

    • Gas chromatography-mass spectrometry (GC-MS): To directly measure the conversion of saturated to unsaturated fatty acids

    • Radiometric assays: Using 14C-labeled substrates to track the introduction of double bonds

    • Oxygen consumption measurements: As molecular oxygen is required for the desaturation reaction

  • Assay Conditions Optimization:

    • Temperature (typically 30°C for S. pombe enzymes)

    • pH (usually 7.2-7.5)

    • Cofactor concentrations (NADH or NADPH, cytochrome b5)

    • Detergent type and concentration for maintaining enzyme activity

  • Data Analysis:

    • Calculate initial reaction rates under various substrate concentrations

    • Determine kinetic parameters (Km, Vmax) using appropriate enzyme kinetics models

    • Compare activity across different conditions or enzyme variants

For in vivo activity assessment, researchers can analyze the fatty acid composition of cellular lipids using techniques such as GC-MS or liquid chromatography-mass spectrometry (LC-MS) to determine the ratio of saturated to unsaturated fatty acids.

How does nitrosative stress affect SPCC1281.06c expression and function?

Gene expression profiling data clearly demonstrates that SPCC1281.06c is downregulated under nitrosative stress conditions in S. pombe . This observation has significant implications for understanding how cells adapt their lipid metabolism during stress responses:

  • Expression Pattern: The acyl-CoA desaturase appears in the list of downregulated genes in response to nitrosative stress, suggesting a specific regulatory mechanism that reduces desaturase activity during this stress condition .

  • Potential Mechanisms:

    • Direct inhibition of transcription factors that promote SPCC1281.06c expression

    • Activation of repressors that specifically target lipid metabolism genes

    • Post-transcriptional mechanisms affecting mRNA stability

  • Functional Significance:

    • Reduction in unsaturated fatty acid production may alter membrane properties to enhance stress resistance

    • Conservation of cellular energy by downregulating non-essential lipid modification pathways

    • Protection of the desaturase enzyme itself from oxidative/nitrosative damage

  • Comparative Response: While SPCC1281.06c is downregulated, other stress-response genes are upregulated, including heat shock proteins like Pdr13, thioredoxin reductase (trr1), and protein disulfide isomerase . This indicates a coordinated cellular response where certain pathways are enhanced while others are suppressed.

This differential regulation pattern provides valuable insight into how S. pombe modulates its lipid metabolism during stress adaptation. The downregulation of SPCC1281.06c may be part of a larger reprogramming of cellular metabolism to prioritize survival mechanisms over growth-related processes.

What role does SPCC1281.06c play in membrane adaptation and lipid homeostasis?

Acyl-CoA desaturase plays a fundamental role in membrane adaptation and lipid homeostasis in S. pombe, contributing to several key aspects of cellular physiology:

  • Membrane Fluidity Regulation:

    • By catalyzing the formation of unsaturated fatty acids, SPCC1281.06c directly influences membrane fluidity, a critical parameter for cellular function

    • The balance between saturated and unsaturated fatty acids determines membrane physical properties including lipid packing and bilayer stiffness

  • Evolutionary Adaptation:

    • Research on related species shows that membrane lipid composition is a target of evolutionary adaptation, with species like S. japonicus showing distinctive lipid profiles with asymmetrical glycerophospholipids

    • The co-evolution of transmembrane proteins with lipid environments suggests that SPCC1281.06c activity must be precisely calibrated to maintain proper membrane-protein interactions

  • Stress Response Integration:

    • Downregulation during nitrosative stress suggests that modifying membrane composition is part of the cellular stress response program

    • This regulation may represent a mechanism to adjust membrane properties to withstand stress conditions

  • Cellular Signaling:

    • Membrane composition affects numerous signaling pathways that depend on lipid microdomains

    • SPCC1281.06c activity could therefore indirectly influence various cellular signaling processes through its effects on membrane structure

Understanding these roles provides insight into how fundamental biological processes like membrane adaptation are coordinated with environmental challenges and evolutionary pressures.

How can researchers investigate the relationship between SPCC1281.06c and the unfolded protein response?

Investigating the relationship between SPCC1281.06c and the unfolded protein response (UPR) requires targeted experimental approaches:

  • Gene Expression Correlation Analysis:

    • Monitor the expression of SPCC1281.06c alongside known UPR markers under various stress conditions

    • Perform time-course experiments to establish temporal relationships between desaturase downregulation and UPR activation

  • Genetic Manipulation Approaches:

    • Create SPCC1281.06c deletion or overexpression strains and assess UPR activation

    • Examine how altered fatty acid desaturation affects UPR signaling components

    • Use domain swap experiments similar to those described in search result to examine transmembrane domain adaptation to different membrane environments

  • Membrane Property Analysis:

    • Retroengineering experiments can be particularly informative, as demonstrated by research showing that S. pombe cells forced to produce altered phospholipids exhibit unfolded protein response and downregulate secretion

    • Measure membrane physical properties (fluidity, thickness, curvature) in cells with modified SPCC1281.06c expression

  • Protein Folding Assessment:

    • Examine folding efficiency of reporter proteins in the presence of altered desaturase activity

    • Track markers of ER stress such as BiP/Kar2 chaperone levels

This research direction is supported by findings that membrane composition significantly impacts protein folding and secretion, with improper lipid environments triggering UPR activation . The observation that retroengineered S. pombe with altered lipid compositions exhibits UPR suggests a mechanistic link between fatty acid desaturation, membrane properties, and protein folding homeostasis.

How should researchers interpret gene expression data for SPCC1281.06c?

When interpreting gene expression data for SPCC1281.06c, researchers should apply a systematic analytical approach:

  • Context-Specific Analysis:

    • Consider the specific conditions under which expression was measured

    • In nitrosative stress studies, SPCC1281.06c appears as a downregulated gene

    • Compare expression patterns across multiple stress conditions to identify specific versus general responses

  • Validation Approaches:

    • Confirm microarray or RNA-seq findings with quantitative PCR, following protocols similar to those used for genes in Table 3

    • Calculate fold changes relative to appropriate housekeeping genes

    • Verify at the protein level using western blotting or mass spectrometry

  • Pathway Integration:

    • Analyze co-regulated genes to identify functional relationships

    • Note that SPCC1281.06c downregulation occurs alongside changes in genes related to protein folding (protein disulfide isomerase), ribosomal proteins, and mitochondrial functions

    • Use pathway enrichment analysis to understand the broader metabolic context

  • Temporal Considerations:

    • Determine whether expression changes are early or late responses

    • Establish if changes are transient or sustained throughout the stress response

  • Comparison with Related Data:

    • Compare expression data with actual membrane lipid composition analysis

    • Correlate with enzymatic activity measurements when available

This comprehensive approach allows researchers to place SPCC1281.06c regulation in the proper biological context and develop testable hypotheses about its role in cellular adaptation.

What bioinformatic approaches can predict substrate specificity of SPCC1281.06c?

Predicting substrate specificity of SPCC1281.06c requires sophisticated bioinformatic approaches:

  • Sequence-Based Methods:

    • Multiple sequence alignment with characterized desaturases from other organisms

    • Identification of conserved catalytic residues and substrate-binding regions

    • Analysis of sequence motifs associated with chain-length specificity

    • Phylogenetic analysis to place SPCC1281.06c in evolutionary context with enzymes of known specificity

  • Structural Prediction:

    • Homology modeling based on available desaturase structures

    • Molecular docking simulations with various fatty acid substrates

    • Molecular dynamics simulations to assess substrate binding stability

    • Analysis of active site geometry and substrate accommodation

  • Machine Learning Applications:

    • Training models using datasets of characterized desaturases with known specificities

    • Feature extraction from protein sequences to identify specificity-determining residues

    • Development of predictive algorithms for substrate preferences

  • Systems Biology Integration:

    • Analysis of metabolic network context to identify likely substrates

    • Examination of co-expressed genes for clues about metabolic pathways

    • Integration with lipidomic data to correlate enzyme expression with fatty acid profiles

These approaches can guide experimental design by generating testable hypotheses about which fatty acid substrates are likely preferred by SPCC1281.06c, potentially focusing on the C16-C18 fatty acids that predominate in S. pombe .

How can researchers overcome expression and purification challenges with recombinant SPCC1281.06c?

Membrane proteins like SPCC1281.06c present significant challenges during recombinant expression and purification. Here are methodological solutions to common issues:

  • Expression Optimization:

    • Test multiple expression hosts including specialized S. pombe strains, S. cerevisiae, and Pichia pastoris

    • Use low-temperature induction (16-20°C) to slow protein production and improve folding

    • Consider fusion partners that enhance folding and stability, such as thioredoxin or maltose-binding protein

    • Optimize codon usage for the expression host

  • Solubilization Strategies:

    • Screen multiple detergents (DDM, LMNG, digitonin) for efficient extraction from membranes

    • Use detergent mixtures or lipid-detergent micelles to maintain native-like environment

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Purification Approach:

    • Implement multistep purification protocols combining affinity chromatography with size exclusion

    • Add lipids during purification to stabilize the protein

    • Minimize exposure to reducing agents that might disrupt essential disulfide bonds

    • Use short purification protocols to reduce time-dependent activity loss

  • Activity Preservation:

    • Include appropriate cofactors throughout the purification process

    • Maintain strict temperature control (usually 4°C)

    • Consider reconstitution into liposomes for activity assays

  • Quality Control Metrics:

    • Use circular dichroism to verify secondary structure integrity

    • Employ thermal shift assays to assess protein stability

    • Confirm homogeneity through dynamic light scattering

These methodological approaches can significantly improve the yield and quality of recombinant SPCC1281.06c, enabling subsequent structural and functional characterization.

What are the best approaches for analyzing SPCC1281.06c in the context of lipid metabolism?

To comprehensively analyze SPCC1281.06c in the context of lipid metabolism, researchers should employ multi-faceted approaches:

This comprehensive approach provides a holistic view of how SPCC1281.06c contributes to lipid metabolism and membrane properties in S. pombe, similar to the approaches used in studying lipid adaptation between S. pombe and S. japonicus .

What does current data reveal about SPCC1281.06c regulation under stress conditions?

Current data provides significant insights into SPCC1281.06c regulation under stress conditions:

Table 1: SPCC1281.06c Regulation in Response to Nitrosative Stress

Gene nameSystematic IDRegulation status
Acyl-coA desaturase (predicted)SPCC1281.06cDownregulated

This downregulation occurs in the context of broader gene expression changes, with other genes showing differential regulation patterns as outlined below :

Table 2: Selected Genes Differentially Regulated Under Nitrosative Stress

Gene nameSystematic IDRegulation status
Acyl-coA desaturase (predicted)SPCC1281.06cDownregulated
Protein disulfide isomeraseSPAC17H9.14cBoth up and downregulated*
Thioredoxin reductase trr1SPBC3F6.03Upregulated (2.4 fold)
C-22 sterol desaturase Erg5SPAC19A8.04Upregulated
Squalene synthase Erg9SPBC646.05cUpregulated

*Note: The dual regulation status of protein disulfide isomerase suggests complex regulation possibly involving different isoforms or time-dependent expression changes.

These data indicate that nitrosative stress induces a coordinated reprogramming of lipid metabolism, with some enzymes being upregulated (sterol metabolism) while others like SPCC1281.06c are downregulated. This selective regulation suggests specific adaptive responses rather than a general suppression of lipid metabolism .

How does SPCC1281.06c compare with acyl-CoA desaturases in related species?

Comparative analysis reveals important differences between SPCC1281.06c and related enzymes:

Table 3: Comparison of Acyl-CoA Desaturases in Schizosaccharomyces Species

FeatureS. pombe (SPCC1281.06c)S. japonicusFunctional Significance
Predominant fatty acid productsC16-C18 monounsaturated FAsContributes to asymmetrical phospholipidsAffects membrane thickness and fluidity
Membrane lipid composition effectGenerates membranes with similar length acyl chainsContributes to membranes with asymmetrical glycerophospholipids (6-8 carbon difference)S. japonicus membranes are stiffer with distinct lipid packing
Response to stressDownregulated under nitrosative stressNot specified in dataSuggests species-specific stress adaptation
Evolutionary adaptationPart of co-evolution with membrane proteinsShows specialized adaptation for asymmetrical lipidsSupports hypothesis that transmembrane helices co-evolve with membranes

This comparative analysis highlights how acyl-CoA desaturases contribute to species-specific membrane properties and adaptation strategies. The distinctive membrane composition of S. japonicus featuring asymmetrical glycerophospholipids suggests specialized roles for desaturases in this species compared to S. pombe .

The research findings support the broader hypothesis that membrane lipid composition and the proteins that determine this composition co-evolve as part of cellular adaptation to different environmental niches .

What are promising future research directions for SPCC1281.06c investigation?

Several promising research directions could advance our understanding of SPCC1281.06c:

  • Structure-Function Analysis:

    • Determination of three-dimensional structure through X-ray crystallography or cryo-EM

    • Mapping of substrate binding sites and catalytic residues through mutagenesis

    • Investigation of conformational changes during catalysis

  • Regulatory Network Mapping:

    • Identification of transcription factors controlling SPCC1281.06c expression

    • Characterization of post-translational modifications affecting activity

    • Analysis of protein-protein interactions involving SPCC1281.06c

  • Evolutionary Studies:

    • Deeper investigation of co-evolution between SPCC1281.06c and membrane proteins

    • Comparative genomics across Schizosaccharomyces species to identify selective pressures

    • Functional complementation studies across species barriers

  • Physiological Role Expansion:

    • Investigation of SPCC1281.06c in cell cycle regulation and division

    • Analysis of its role in stress adaptation beyond nitrosative stress

    • Examination of potential contributions to specialized cellular structures

  • Technological Applications:

    • Engineering SPCC1281.06c with modified substrate specificity

    • Development as a biotechnological tool for producing specific unsaturated fatty acids

    • Design of inhibitors or activators as research tools

These research directions build upon the existing knowledge of SPCC1281.06c while expanding into new territories of investigation that could reveal unexpected functions and applications of this important enzyme.

How can cross-disciplinary approaches enhance SPCC1281.06c research?

Cross-disciplinary approaches can significantly enhance research on SPCC1281.06c:

  • Integration of Biophysics and Molecular Biology:

    • Combine membrane biophysics with genetic approaches to understand how SPCC1281.06c-mediated changes in lipid composition affect membrane properties

    • Use advanced imaging techniques like super-resolution microscopy to examine enzyme localization and membrane domain formation

  • Computational Biology and Experimental Validation:

    • Develop computational models predicting substrate specificity and reaction mechanisms

    • Use molecular dynamics simulations to understand membrane-protein interactions

    • Validate predictions through targeted experimental approaches

  • Systems Biology Framework:

    • Place SPCC1281.06c in the context of genome-scale metabolic models

    • Analyze flux distributions under different conditions

    • Identify emergent properties not apparent from isolated studies

  • Evolutionary Biology Perspectives:

    • Apply phylogenetic approaches to trace the evolutionary history of desaturases

    • Examine how membrane composition and desaturase function co-evolved

    • Test hypotheses about adaptive advantages through competition experiments

  • Synthetic Biology Applications:

    • Engineer synthetic pathways incorporating SPCC1281.06c

    • Create minimal systems to study desaturase function in controlled environments

    • Develop biosensors based on membrane properties affected by desaturase activity

By integrating these diverse approaches, researchers can develop a more comprehensive understanding of SPCC1281.06c function and its broader biological significance in cellular adaptation and membrane homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.