Recombinant Schizosaccharomyces pombe Probable C-5 sterol desaturase 1 (SPAC1687.16c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
erg31; erg3; SPAC1687.16c; Delta(7-sterol 5(6-desaturase erg31; C-5 sterol desaturase erg31; Ergosterol Delta(5,6 desaturase erg31; Ergosterol biosynthesis protein 31; Sterol-C5-desaturase erg31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erg31
Target Protein Sequence
MDYLLNYADQYALDSIYNAVYPLARDNIVRQSISLFFLTWFGGMFLYLTFASLSYQFVFD KSLMDHPKFLKNQVFMEVLTALQNLPGMALLTVPWFLAELHGYSYLYDNISDYGLKYFLC SLPLFVMFSDFGIYWAHRFLHHRYVYPRLHKLHHKWIICTPYASHAFKSADGFLQSLPYH LFPFFFPLHKLTYLALFTFVNFWSIMIHDGKYISNNPIINGAAHHNGHHIYFNYNYGQFT TLFDRLGNSFRAPDEAWFDKDLRQNEDVLRVELMEYEAIRNEVEGDDDREYIANSAKKNH
Uniprot No.

Target Background

Function
This enzyme catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. It is involved in the biosynthesis of ergosterol, which is crucial for plasma membrane structure and function, as well as the localization of plasma membrane proteins.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Probable C-5 sterol desaturase 1 (SPAC1687.16c)?

SPAC1687.16c encodes the probable C-5 sterol desaturase in Schizosaccharomyces pombe, which is a highly conserved enzyme across eukaryotes . This enzyme is also annotated as ERG3 and functions as a C-5 sterol desaturase in the ergosterol biosynthetic pathway in fission yeast . The enzyme catalyzes the critical dehydrogenation of a C-5(6) bond in a sterol intermediate compound as part of the biosynthesis of major sterols . In gene expression studies, ERG3 has been shown to be upregulated under specific conditions, with a 3.92-fold change in wild-type samples without oxygen, indicating its importance in anaerobic metabolism .

The enzyme belongs to a family of desaturases that are integral to sterol biosynthesis across diverse organisms but with substrate specificity that varies by species. While human C-5 sterol desaturase oxidizes lathosterol, the yeast ortholog in Saccharomyces cerevisiae oxidizes episterol, and a similar substrate specificity is expected for the S. pombe enzyme .

How is C-5 sterol desaturase involved in the sterol biosynthesis pathway of S. pombe?

In Schizosaccharomyces pombe, the C-5 sterol desaturase (SPAC1687.16c/ERG3) catalyzes a critical step in the ergosterol biosynthetic pathway, which is the fungal equivalent of the cholesterol pathway in mammals . The enzyme specifically catalyzes the dehydrogenation reaction that introduces a double bond at the C-5(6) position of an episterol intermediate . This reaction is essential for the proper synthesis of ergosterol, which is a fundamental component of fungal cell membranes.

The ergosterol biosynthetic pathway in S. pombe involves multiple enzymes working in sequence, including ERG11 (C-14 lanosterol demethylase), ERG25 (C-4 methylsterol oxidase), ERG5 (C-22 sterol desaturase), and ERG1 (squalene monooxygenase), all of which show coordinated expression patterns, particularly under anaerobic conditions . This pathway is regulated by transcription factors such as Sre1p, which serves as a principal activator of anaerobic gene expression and upregulates genes required for nonrespiratory oxygen consumption, including those involved in ergosterol metabolism .

What conserved structural features are important for C-5 sterol desaturase function?

C-5 sterol desaturase contains several highly conserved structural features that are crucial for its catalytic function. Most notably, the enzyme possesses a conserved cluster of histidine residues that, when mutated (as demonstrated in Arabidopsis thaliana), dramatically reduce or eliminate enzyme activity . This conservation suggests the involvement of a coordinated iron cation in the reaction mechanism across different species .

The reaction mechanism proposed by Rahier involves an iron-coordinated oxygen that abstracts a hydrogen from the substrate, leading to a radical intermediate . This mechanism highlights the importance of the metal coordination site for the enzyme's catalytic activity. When working with recombinant SPAC1687.16c, preserving these conserved structural elements is essential for maintaining enzymatic function in experimental studies.

What transformation methods are most effective for studying SPAC1687.16c in S. pombe?

For efficient transformation of S. pombe to study SPAC1687.16c, a lithium acetate and polyethylene glycol-based method has been well-established . This approach typically yields transformation efficiencies between 1.0×10³ and 1.0×10⁴ transformants per microgram of plasmid DNA, making it suitable for most genetic manipulation experiments involving SPAC1687.16c .

The detailed protocol involves:

  • Preparation of 102 g of LiOAc (dihydrate) dissolved in deionized water and autoclave sterilized .

  • Creation of 44% Polyethylene Glycol-3350 by dissolving 440 g PEG 3350 in deionized water to a final volume of 1 liter, followed by filter sterilization .

  • Preparation of an experimental transformation plasmid mixture with carrier DNA (herring sperm DNA) for the 96-well format, combining 500 μL of plasmid (1 μg/μL) with 500 μL of carrier DNA .

How is the expression of SPAC1687.16c regulated under different environmental conditions?

The expression of SPAC1687.16c (ERG3) is significantly regulated by environmental conditions, particularly oxygen availability. Under anaerobic conditions, ERG3 shows a 3.92-fold increase in expression in wild-type samples, highlighting its importance in adapting to oxygen limitation .

This regulation appears to be primarily controlled by the transcription factor Sre1p, which acts as a principal activator of anaerobic gene expression in S. pombe . Sre1p itself shows a 4.75-fold increase in expression under anaerobic conditions, coordinating the upregulation of multiple genes involved in ergosterol metabolism, including ERG3, ERG25, ERG11, ERG5, and ERG1 .

The relationship between Sre1p and sterol biosynthesis genes can be studied using reporter constructs. For instance, sre1 fused to lacZ reporter vectors can be generated by inserting genomic fragments amplified by PCR into appropriate vectors such as pSPE376 . This approach allows researchers to study the promoter elements controlling SPAC1687.16c expression, including sterol regulatory elements (SREs) that are likely binding sites for Sre1p .

The table below shows the expression changes of ERG3 and related genes under anaerobic conditions:

Gene IDS. cerevisiae orthologDescriptionFold change (WT -O₂/+O₂)Fold change (sre1Δ -O₂/+O₂)
SPAC1687.16cERG3C-5 sterol desaturase3.922.36
erg25+ERG25C-4 methylsterol oxidase3.143.05
erg11+ERG11Cytochrome P450; C-14 lanosterol demethylase2.941.29
erg5+ERG5Cytochrome P450; C-22 sterol desaturase2.761.34
erg1+ERG1Squalene monooxygenase2.470.93

What are the enzymatic characteristics of C-5 sterol desaturase that affect experimental design?

C-5 sterol desaturase exhibits several enzymatic characteristics that researchers should consider when designing experiments. The enzyme couples sterol oxidation to the oxidation of NAD(P)H and the reduction of molecular oxygen . Importantly, the enzyme can utilize either NADH or NADPH as a cofactor, though the preference may vary between species . For instance, in Arabidopsis thaliana, the enzyme catalyzes the reaction twice as fast with NADH, while in Saccharomyces cerevisiae, the enzyme shows little preference .

The reaction mechanism likely involves a coordinated iron cation, as suggested by the conserved histidine cluster . This metal cofactor requirement means that experimental conditions must maintain appropriate iron availability and oxidation state. The proposed reaction mechanism involves an iron-coordinated oxygen abstracting a hydrogen from the substrate, leading to a radical intermediate , which may have implications for the stability of the enzyme under various experimental conditions.

When designing activity assays for recombinant SPAC1687.16c, researchers should consider testing both NADH and NADPH as potential cofactors to determine the optimal substrate for the S. pombe enzyme. Additionally, ensuring proper metal ion availability (particularly iron) in the reaction buffer is crucial for maintaining enzyme activity.

How can I express and purify recombinant S. pombe C-5 sterol desaturase for biochemical studies?

Expressing and purifying functional recombinant S. pombe C-5 sterol desaturase presents several challenges due to its nature as a membrane-bound enzyme. A methodological approach would include:

  • Expression System Selection: While E. coli is commonly used for recombinant protein expression, membrane proteins like C-5 sterol desaturase often require eukaryotic expression systems. Consider using S. cerevisiae, Pichia pastoris, or insect cell expression systems, which provide the appropriate membrane environment and post-translational modifications .

  • Vector Design: Create a construct with a strong, inducible promoter and incorporate affinity tags (such as His6 or FLAG) for purification. Position the tag carefully to avoid interfering with protein folding or activity. A fusion with green fluorescent protein (GFP) can also help monitor expression and localization.

  • Membrane Protein Solubilization: After expression, solubilize the membrane fraction using detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS that maintain protein structure and function. Optimize detergent concentration through small-scale tests before proceeding to larger preparations.

  • Purification Strategy: Use affinity chromatography based on the incorporated tag, followed by size exclusion chromatography to obtain pure protein. All buffers should contain the optimized detergent at concentrations above its critical micelle concentration to keep the protein solubilized.

  • Activity Verification: Confirm the activity of the purified enzyme using a spectrophotometric assay that monitors NAD(P)H oxidation at 340 nm . Both NADH and NADPH should be tested as cofactors since preferences may vary across species .

Researchers should be aware that maintaining the native conformation and activity of membrane proteins during purification is challenging and may require extensive optimization of conditions.

What methods can be used to create and verify mutants of SPAC1687.16c in S. pombe?

Creating and verifying mutants of SPAC1687.16c in S. pombe requires a systematic approach:

  • Mutagenesis Design:

    • For site-directed mutagenesis, focus on conserved histidine residues that are likely involved in iron coordination and catalysis .

    • For promoter studies, use splice overlap PCR to generate mutations in potential regulatory elements, such as those used for the sre1 promoter (SRE1, SRE2, or SRE3) .

  • Transformation Method:

    • Use the lithium acetate and polyethylene glycol-based transformation protocol optimized for S. pombe .

    • For the transformation mixture, combine 500 μL of plasmid (1 μg/μL) with 500 μL of herring sperm carrier DNA .

    • Typical transformation efficiencies range between 1.0×10³ and 1.0×10⁴ transformants per microgram of plasmid DNA .

  • Verification Strategies:

    • Genomic PCR to confirm the presence of the desired mutation.

    • Sequencing to verify the exact nucleotide changes.

    • Expression analysis using quantitative PCR to assess any changes in transcription levels.

    • For functional studies, assess growth phenotypes under various conditions, particularly those requiring ergosterol biosynthesis.

    • Analyze sterol profiles using gas chromatography-mass spectrometry (GC-MS) to determine changes in lipid composition resulting from the mutation.

  • Reporter Systems:

    • For promoter studies, use lacZ reporter constructs to measure the effect of mutations on gene expression .

    • For protein function studies, consider creating GFP fusion proteins to monitor localization and expression levels.

When working with deletion or mutation strains, researchers should be careful to maintain proper controls and be aware that some S. pombe strains may transform with lower efficiencies than others .

How can I analyze the impact of SPAC1687.16c mutations on ergosterol biosynthesis?

Analyzing the impact of SPAC1687.16c mutations on ergosterol biosynthesis requires a multi-faceted approach:

  • Sterol Profiling by Chromatography:

    • Extract total sterols from wild-type and mutant S. pombe cells using chloroform-methanol extraction.

    • Analyze the sterol composition by gas chromatography-mass spectrometry (GC-MS).

    • Look for accumulation of substrate intermediates (such as episterol) and reduction in ergosterol levels in mutants.

    • Quantify the ratio of different sterols to determine the specific step affected by the mutation.

  • Growth Phenotype Analysis:

    • Assess growth under standard conditions and under stress that might reveal ergosterol-related phenotypes (e.g., antifungal agents that target ergosterol, temperature stress, osmotic stress).

    • Perform complementation studies with wild-type SPAC1687.16c to confirm that observed phenotypes are directly related to the mutation.

  • Gene Expression Analysis:

    • Use quantitative PCR or RNA sequencing to examine how mutations in SPAC1687.16c affect the expression of other genes in the ergosterol biosynthetic pathway.

    • Pay particular attention to potential compensatory mechanisms that might be activated in response to disrupted ergosterol synthesis.

  • Membrane Integrity and Function Tests:

    • Examine membrane fluidity using fluorescence polarization techniques with probes like DPH (1,6-diphenyl-1,3,5-hexatriene).

    • Assess membrane permeability using dye exclusion tests or sensitivity to detergents.

    • Investigate the functionality of membrane proteins that might be affected by changes in ergosterol content.

  • Analysis Under Anaerobic Conditions:

    • Compare the phenotypic effects of mutations under both aerobic and anaerobic conditions, given that ERG3 expression is significantly upregulated (3.92-fold) under anaerobic conditions .

    • Investigate the relationship between the Sre1p transcription factor and SPAC1687.16c under these conditions, as Sre1p is a principal activator of anaerobic gene expression .

How should I interpret contradictory results when analyzing SPAC1687.16c function?

When encountering contradictory results in SPAC1687.16c functional studies, a systematic approach to interpretation is essential:

  • Experimental Condition Variations:

    • First, evaluate differences in experimental conditions between studies. C-5 sterol desaturase activity is influenced by oxygen availability, with significant expression changes (3.92-fold) under anaerobic versus aerobic conditions .

    • Consider variations in media composition, temperature, pH, and growth phase, which can all affect enzyme expression and activity.

    • Examine whether different strain backgrounds were used, as genetic interactions may influence the phenotypic outcomes of SPAC1687.16c mutations.

  • Methodological Differences:

    • Assess differences in the transformation protocols used, as transformation efficiency can vary significantly between strains and methods .

    • Compare purification methods if working with recombinant protein, as membrane protein functionality is highly dependent on solubilization and purification conditions.

    • Consider the sensitivity and specificity of different assays used to measure enzyme activity or sterol profiles.

  • Resolution Strategies:

    • Directly compare contradictory results by replicating both experimental conditions in parallel.

    • Implement multiple complementary assays to assess the same parameter from different angles.

    • Consider epistasis analysis by creating double mutants with other genes in the ergosterol pathway to clarify the specific role of SPAC1687.16c.

    • Use reporter constructs (such as sre1-lacZ) to quantitatively measure promoter activity under different conditions .

  • Data Integration Framework:

    • Develop a comprehensive model that accounts for condition-specific effects on enzyme function.

    • Consider that seemingly contradictory results may reflect different aspects of a complex regulatory network rather than actual contradictions.

    • Contextualize results within the broader understanding of sterol desaturases across species, noting that while the enzymes share conserved features (like histidine clusters), specifics of substrate preference and regulation may vary .

When encountering contradictory results related to cytoplasmic state or protein behavior during experimental procedures, consider techniques from cytoplasmic freezing research to ensure consistent sample preparation and analysis .

What approaches can be used to compare C-5 sterol desaturase activity across different species?

Comparing C-5 sterol desaturase activity across different species requires specialized approaches to account for variations in substrate specificity, cofactor preference, and regulatory mechanisms:

  • Heterologous Expression Systems:

    • Express C-5 sterol desaturases from different species (e.g., S. pombe, S. cerevisiae, A. thaliana, H. sapiens) in a common host system to minimize variables related to cellular environment.

    • Use identical affinity tags and purification protocols to ensure comparable protein preparations.

    • Verify protein expression levels and membrane integration using Western blotting and fluorescence microscopy if using GFP fusions.

  • Standardized Activity Assays:

    • Develop a unified spectrophotometric assay that monitors NAD(P)H oxidation at 340 nm for all enzymes being compared .

    • Test both NADH and NADPH as cofactors for each enzyme, as preferences may vary (e.g., A. thaliana C-5 sterol desaturase catalyzes the reaction twice as fast with NADH, while S. cerevisiae enzyme shows little preference) .

    • Use substrate analogs that can be processed by enzymes from all species being compared to establish a common activity metric.

  • Complementation Studies:

    • Introduce C-5 sterol desaturases from different species into an S. pombe erg3Δ background.

    • Assess the ability of each ortholog to rescue the phenotypic defects associated with erg3 deletion.

    • Compare growth rates, sterol profiles, and membrane properties to quantify the degree of functional conservation.

  • Structural Comparisons:

    • Perform sequence alignments focusing on conserved features such as histidine clusters implicated in iron coordination .

    • Use homology modeling to predict structural differences that might account for functional variations.

    • Pay particular attention to residues implicated in substrate binding and catalysis, such as threonine 114 in A. thaliana (which is a serine in humans, mice, and yeast) .

  • Analysis Framework:

    • Develop a comparative matrix that includes kinetic parameters (Km, Vmax), cofactor preferences (NADH vs. NADPH), substrate specificities, and regulatory responses for each species.

    • Normalize activity data to account for differences in expression levels or membrane integration efficiency.

    • Consider evolutionary context when interpreting differences, taking into account the specific sterol biosynthetic pathways in each organism (ergosterol in fungi vs. cholesterol in animals vs. phytosterols in plants) .

This comprehensive approach will provide insights into both the conserved catalytic mechanism shared across eukaryotes and the species-specific adaptations that have evolved in different sterol biosynthetic pathways.

What are the most common technical challenges when working with recombinant SPAC1687.16c?

Researchers working with recombinant SPAC1687.16c encounter several technical challenges that require specific strategies to overcome:

  • Membrane Protein Expression Issues:

    • As a membrane-bound enzyme, SPAC1687.16c often shows low expression levels and can be toxic to host cells when overexpressed.

    • Strategy: Use tightly regulated inducible promoters, optimize induction conditions (temperature, inducer concentration, duration), and consider specialized host strains designed for membrane protein expression.

    • Alternative approach: Express the protein as a fusion with solubilizing partners like MBP (maltose-binding protein) or SUMO, with an appropriate protease cleavage site.

  • Maintaining Enzyme Activity During Purification:

    • The enzyme requires specific lipid environments and cofactors (including iron for the histidine cluster) .

    • Strategy: Screen multiple detergents for solubilization, include glycerol or other stabilizing agents in purification buffers, and consider adding lipids that mimic the native membrane environment.

    • Include metal chelators during early purification steps to prevent oxidative damage, but ensure proper metal reconstitution before activity assays.

  • Activity Assay Challenges:

    • The enzyme couples sterol oxidation to NAD(P)H oxidation and oxygen reduction, making direct activity measurements complex .

    • Strategy: Develop a coupled enzyme assay system that generates continuous spectrophotometric readouts.

    • For substrate analysis, implement HPLC or GC-MS methods to directly measure substrate consumption and product formation.

  • Genetic Manipulation Difficulties:

    • Some S. pombe strains show significantly lower transformation efficiencies .

    • Strategy: Optimize the lithium acetate and polyethylene glycol-based transformation protocol for specific strains, potentially increasing DNA concentration or carrier DNA amount for difficult strains.

    • Consider alternative transformation methods such as electroporation for strains that remain recalcitrant to standard protocols.

  • Storage and Stability:

    • Membrane proteins often lose activity during freeze-thaw cycles or prolonged storage.

    • Strategy: Explore cytoplasmic freezing methodology insights for preserving protein samples .

    • Optimize cryoprotectant composition and test small aliquots for activity retention after various storage conditions.

By anticipating these challenges and implementing appropriate technical solutions, researchers can significantly improve their success rate when working with this complex membrane enzyme.

How can I design experiments to investigate the role of SPAC1687.16c under different stress conditions?

Designing experiments to investigate SPAC1687.16c's role under different stress conditions requires a systematic approach:

  • Stress Condition Selection:

    • Focus on conditions relevant to ergosterol function: temperature stress (both heat and cold), osmotic stress, oxidative stress, and antifungal agents that target ergosterol biosynthesis.

    • Include anaerobic stress, given that ERG3 shows significant upregulation (3.92-fold) under anaerobic conditions .

    • Consider cell wall stressors, as ergosterol plays a role in cell wall integrity signaling in fungi.

  • Strain Development:

    • Generate multiple alleles of SPAC1687.16c: complete deletion, catalytic site mutations (targeting conserved histidine residues) , and temperature-sensitive alleles.

    • Create strains with fluorescent tags to monitor protein localization and expression levels under stress.

    • Develop promoter-reporter constructs (such as SPAC1687.16c-lacZ) to quantitatively measure transcriptional responses .

  • Experimental Design Matrix:

    • Implement a factorial design comparing wild-type and mutant strains across multiple stress conditions and time points.

    • Include dose-response relationships for chemical stressors to identify threshold effects.

    • Design time-course experiments to distinguish between immediate and adaptive responses.

  • Multi-omics Integration:

    • Combine transcriptomics (RNA-seq) to measure gene expression changes, proteomics to assess protein levels and modifications, and lipidomics to analyze sterol profiles.

    • Use chromatin immunoprecipitation (ChIP) to investigate Sre1p binding to the SPAC1687.16c promoter under different stress conditions, given Sre1p's role as a principal activator of anaerobic gene expression .

    • Implement metabolic flux analysis using isotope-labeled precursors to track changes in ergosterol biosynthesis rates.

  • Phenotypic Characterization:

    • Measure growth rates, cell morphology, and viability under each stress condition.

    • Assess membrane fluidity and permeability using fluorescent probes.

    • Evaluate cell wall integrity using dyes like calcofluor white or congo red.

    • Examine cellular ultrastructure using electron microscopy to detect any membrane abnormalities.

  • Data Analysis Framework:

    • Develop stress-specific signatures of SPAC1687.16c function by integrating phenotypic and molecular data.

    • Implement principal component analysis or other dimension reduction techniques to identify key variables that discriminate between wild-type and mutant responses.

    • Use network analysis to place SPAC1687.16c within the broader stress response pathways of S. pombe.

This comprehensive experimental design will provide insights into both the direct enzymatic function of SPAC1687.16c and its broader role in cellular stress adaptation.

What are the future research directions for SPAC1687.16c studies?

The study of SPAC1687.16c (C-5 sterol desaturase) in S. pombe presents several promising future research directions:

  • Structural Biology Approaches:

    • Determine the high-resolution structure of SPAC1687.16c using cryo-electron microscopy or X-ray crystallography, focusing on the conserved histidine cluster that likely coordinates iron in the catalytic site .

    • Use structure-guided mutagenesis to precisely define the roles of specific residues in substrate binding and catalysis.

    • Compare structural features with C-5 sterol desaturases from other organisms to understand evolutionary adaptations in the enzyme mechanism.

  • Systems Biology Integration:

    • Map the complete regulatory network controlling SPAC1687.16c expression, expanding on the known role of Sre1p as a principal activator under anaerobic conditions .

    • Investigate potential crosstalk between ergosterol biosynthesis and other cellular processes such as cell cycle regulation, membrane trafficking, and stress responses.

    • Develop comprehensive mathematical models of sterol biosynthesis that predict the effects of SPAC1687.16c mutations or environmental perturbations.

  • Technological Innovations:

    • Develop optogenetic tools to precisely control SPAC1687.16c expression or activity in real-time.

    • Implement CRISPR-Cas9 screens to identify synthetic lethal or synthetic rescue interactions with SPAC1687.16c.

    • Create biosensors that report on ergosterol levels or membrane properties in living cells.

  • Translational Applications:

    • Explore the potential of SPAC1687.16c as a target for novel antifungal agents, given its essential role in ergosterol biosynthesis.

    • Investigate the possibility of engineering S. pombe strains with modified SPAC1687.16c to produce novel sterols with biotechnological applications.

    • Compare the properties of fungal C-5 sterol desaturases with their human counterparts to develop selective inhibitors for medical applications.

  • Evolutionary and Comparative Studies:

    • Conduct comprehensive phylogenetic analyses of C-5 sterol desaturases across the tree of life to understand the evolution of substrate specificity and cofactor preference .

    • Investigate horizontal gene transfer events that might have shaped the distribution and diversity of these enzymes.

    • Study natural variation in SPAC1687.16c sequences and activities across wild S. pombe isolates to understand adaptive significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.